Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29150 76 / 4e-18 RPN6, ATS9 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042184 [exp] 83 / 1e-20 AT1G29150 425 / 2e-148 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Lus10008632 [exp] 83 / 2e-20 AT1G29150 721 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Lus10036805 [exp] 81 / 9e-20 AT1G29150 718 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Lus10037125 [exp] 80 / 2e-19 AT1G29150 721 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G164200 [exp] 78 / 8e-19 AT1G29150 634 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Potri.008G042400 [exp] 78 / 1e-18 AT1G29150 611 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Potri.013G020300 [exp] 75 / 9e-18 AT1G29150 634 / 0.0 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1) Potri.006G277900 [exp] 55 / 1e-10 AT1G29150 498 / 1e-175 REGULATORY PARTICLE NON-ATPASE 6, non-ATPase subunit 9 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029167 pacid=23151788 polypeptide=Lus10029167 locus=Lus10029167.g ID=Lus10029167.BGIv1.0 annot-version=v1.0 ATGGTCGAGATTGGACATATCGCCGAGCTGATCGAACTGCCTGTCGATCACGTGGAGAAGAAGCTATGGCAGATGATTCTGGACAAGAAGTTTGCTGGAA CTTGGATCCCGAGACGGATGCGGTATATCCGGATACGTTGGAGACCATTGCCAAATATGGGGAAGGTGGTTGATAGTTTGTATGGGAGGTCTGCTTCGAT TATGGCGTGA
AA sequence Show only first row Show all	>Lus10029167 pacid=23151788 polypeptide=Lus10029167 locus=Lus10029167.g ID=Lus10029167.BGIv1.0 annot-version=v1.0 MVEIGHIAELIELPVDHVEKKLWQMILDKKFAGTWIPRRMRYIRIRWRPLPNMGKVVDSLYGRSASIMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29150		RPN6, ATS9	REGULATORY PARTICLE NON-ATPASE...		Lus10029167 [exp]	0	1
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10000405 [exp]	4.5	0.7177
AT4G36870	HD	BLH2, SAW1	SAWTOOTH 1, BEL1-like homeodom...		Lus10016790 [exp]	13.7	0.7269
AT2G35612			unknown protein		Lus10033285 [exp]	16.1	0.7046
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017766 [exp]	25.4	0.6316
AT5G55980			serine-rich protein-related (....		Lus10008880 [exp]	26.2	0.6250
AT1G78780			pathogenesis-related family pr...		Lus10037316 [exp]	30.0	0.5794
AT5G62500		ATEB1B	end binding protein 1B (.1)		Lus10023606 [exp]	31.2	0.6238
AT3G04890			Uncharacterized conserved prot...		Lus10009193 [exp]	43.1	0.6000
AT4G28040			nodulin MtN21 /EamA-like trans...		Lus10015498 [exp]	44.0	0.5806
					Lus10017767 [exp]	82.0	0.5696

Compare expression of checked genes

Lus10029167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.