Lus10029189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010705 86 / 2e-23 AT1G24050 135 / 2e-41 RNA-processing, Lsm domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G095601 79 / 2e-20 AT1G24050 166 / 1e-52 RNA-processing, Lsm domain (.1)
Potri.008G146200 77 / 2e-19 AT1G24050 167 / 5e-53 RNA-processing, Lsm domain (.1)
PFAM info
Representative CDS sequence
>Lus10029189 pacid=23151663 polypeptide=Lus10029189 locus=Lus10029189.g ID=Lus10029189.BGIv1.0 annot-version=v1.0
ATGGAAGGTAGCAACATCAGCAGCGAGGACTTCGCAATAGGCTGCTTTCTCTCCATCAAAACCACCTTAGGCGAAGAATTCGAAGGCCAAGTCATCACCT
TCGACCGCCCTTCCAACATCCTCGTCCTTCATATCCTTTTTCACCTCTGTTCTCAAATAATTTTCCTTGATAATCCGTCGTGA
AA sequence
>Lus10029189 pacid=23151663 polypeptide=Lus10029189 locus=Lus10029189.g ID=Lus10029189.BGIv1.0 annot-version=v1.0
MEGSNISSEDFAIGCFLSIKTTLGEEFEGQVITFDRPSNILVLHILFHLCSQIIFLDNPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029189 0 1
AT3G01380 transferases;sulfuric ester hy... Lus10039444 3.3 0.8196
AT4G39280 phenylalanyl-tRNA synthetase, ... Lus10032123 13.4 0.8194
AT1G25260 Ribosomal protein L10 family p... Lus10043280 25.5 0.8091
AT5G63220 unknown protein Lus10036505 34.9 0.7948
AT1G80750 Ribosomal protein L30/L7 famil... Lus10019603 42.9 0.7737
AT5G59210 myosin heavy chain-related (.1... Lus10040740 59.7 0.7707
AT5G58100 unknown protein Lus10008552 60.2 0.7410
AT4G11120 translation elongation factor ... Lus10012296 62.7 0.7506
AT1G30620 MURUS4, HSR8, U... UDP-D-XYLOSE 4-EPIMERASE 1, MU... Lus10003496 70.2 0.7388
AT5G63000 Mitochondrial import inner mem... Lus10027691 83.6 0.7317

Lus10029189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.