Lus10029192 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010734 223 / 2e-73 AT1G69980 159 / 1e-47 unknown protein
Lus10012669 209 / 1e-68 ND /
Lus10009191 207 / 1e-68 ND /
Lus10024766 207 / 3e-68 ND /
Lus10010252 179 / 3e-56 ND /
Lus10010593 172 / 1e-55 ND /
Lus10034512 171 / 2e-55 ND /
Lus10025380 180 / 4e-53 AT3G07610 516 / 8e-170 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3)
Lus10033972 166 / 3e-52 AT4G15610 46 / 3e-06 Uncharacterised protein family (UPF0497) (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029192 pacid=23151772 polypeptide=Lus10029192 locus=Lus10029192.g ID=Lus10029192.BGIv1.0 annot-version=v1.0
ATGTCTTCAAGCAAGTCTAACGAGAATGTTATGAACAAGTTTTGCCGCCCTGATGAGTCAAATGATTTGTTCACCTACTTTGGAGAAGAAGTGAAGGGCG
ATTGCGGATTTCGTGCAGCGAGACTAATGACGCTGAAGTTCGAGAAATACTTTAATTGTCCTTTCTATAAGTGTAGGTTCGAGAAGAAGTTGGAGGTGGT
GTTGGCTGAGAACTCGGTGGGACGCGAGATGAGAGCTACAATGGAGGCGAAGCTTGCTAAGAAAGATGCTGAGATTGAAGCTGTTCGTGCTGAGCTGGCA
CATGATCGTTCTGAACGGCAACGTGAGAGGATAGACATCATACAGTCAAATGATAGGTACATCGAGACTCTCAGTGAAAAGTTGAAGGAAGCAAATATGA
AGAACGTGGATGAGGTCTCTCAGTGCGGCGGACAACAGAACGGTGATGCTGTGGATGACCACGAGCTTGATGACGAGCCTGAGTACGATCCGGGTAACAA
CCACGGAGAAGGGGGAGATGAATAG
AA sequence
>Lus10029192 pacid=23151772 polypeptide=Lus10029192 locus=Lus10029192.g ID=Lus10029192.BGIv1.0 annot-version=v1.0
MSSSKSNENVMNKFCRPDESNDLFTYFGEEVKGDCGFRAARLMTLKFEKYFNCPFYKCRFEKKLEVVLAENSVGREMRATMEAKLAKKDAEIEAVRAELA
HDRSERQRERIDIIQSNDRYIETLSEKLKEANMKNVDEVSQCGGQQNGDAVDDHELDDEPEYDPGNNHGEGGDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029192 0 1
AT4G10020 ATHSD5 hydroxysteroid dehydrogenase 5... Lus10001280 5.4 1.0000
AT1G12570 Glucose-methanol-choline (GMC)... Lus10002957 8.0 1.0000
AT3G20760 Nse4, component of Smc5/6 DNA ... Lus10004185 9.9 1.0000
AT5G46795 MSP2 microspore-specific promoter ... Lus10004566 12.4 1.0000
Lus10010609 13.2 1.0000
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 13.4 1.0000
Lus10009800 13.9 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10010756 15.2 1.0000
Lus10010778 16.7 1.0000
Lus10011496 18.5 1.0000

Lus10029192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.