Lus10029197 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05680 189 / 1e-58 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT2G43840 187 / 1e-57 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
AT1G24100 183 / 2e-56 UGT74B1 UDP-glucosyl transferase 74B1 (.1)
AT1G05675 183 / 3e-56 UDP-Glycosyltransferase superfamily protein (.1)
AT2G43820 180 / 4e-55 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
AT2G31790 180 / 5e-55 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31750 173 / 2e-52 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT1G05560 149 / 3e-43 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
AT3G21560 144 / 5e-41 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05530 142 / 2e-40 UGT75B2, UGT2 UDP-GLUCOSYL TRANSFERASE 2, UDP-glucosyl transferase 75B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010712 276 / 2e-92 AT1G24100 462 / 1e-160 UDP-glucosyl transferase 74B1 (.1)
Lus10008742 201 / 8e-63 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10006351 173 / 5e-54 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10024486 176 / 2e-53 AT1G05680 389 / 4e-132 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10006353 174 / 1e-52 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10014148 174 / 1e-52 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10006721 169 / 1e-50 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10024117 169 / 2e-50 AT1G05675 385 / 4e-130 UDP-Glycosyltransferase superfamily protein (.1)
Lus10006352 167 / 5e-50 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G032500 203 / 9e-64 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032300 199 / 3e-62 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G032700 194 / 1e-60 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032733 194 / 1e-60 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.004G179300 194 / 2e-60 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.001G389200 191 / 4e-59 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.007G140300 189 / 1e-58 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.014G175000 186 / 2e-57 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.007G140500 180 / 5e-55 AT2G43840 463 / 3e-161 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.007G117200 178 / 2e-54 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10029197 pacid=23151726 polypeptide=Lus10029197 locus=Lus10029197.g ID=Lus10029197.BGIv1.0 annot-version=v1.0
ATGGAAGCCACTCAACGACGAGTGCACGAAGTGGCTGGTGTGAAATCAGTAGCATTCATCTCATTTGGGAGCATGGTTTCCCTGACGGAAGAACAGACTG
CAGAATTCGCAGGAGGGTTGGAGGAATCCGATGTGGAGTTCTTGTGGGTGGTGCGAGAATCAGAGCTAAGCAAGCTCCCCAAATGGTTTAGGGAGTCGTT
AAGTTCTTCGAGTTCGAAGGGTCTAATAGTGCCGTGGTGTAACCAGCTCGAAATGGTGGGACACAGGGCCACTGGATGCTTTGTGACACACTGCGGCTGG
AACTCGACGCTCGAAGGGCTGAGCCTCGGCGTGCCCATGGTGGCTATGCCGCAGTGGACCGATCAGGTCACCAACGCCAAGTACATCGAGGATGTGTCGA
GGGTTGGTGTTAGAGTGAAGGAAGATGAGAGTGGGGTTGCTCGAAGAGAGGAGATAGCGAAGTGCTTGAAGGAAGTGATGTCGGAAGGTGATCGGAGCAA
GGAGATTAAGGAAGCTGCGAGGAAATGGAGGTGA
AA sequence
>Lus10029197 pacid=23151726 polypeptide=Lus10029197 locus=Lus10029197.g ID=Lus10029197.BGIv1.0 annot-version=v1.0
MEATQRRVHEVAGVKSVAFISFGSMVSLTEEQTAEFAGGLEESDVEFLWVVRESELSKLPKWFRESLSSSSSKGLIVPWCNQLEMVGHRATGCFVTHCGW
NSTLEGLSLGVPMVAMPQWTDQVTNAKYIEDVSRVGVRVKEDESGVARREEIAKCLKEVMSEGDRSKEIKEAARKWR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Lus10029197 0 1
AT1G60790 TBL2 TRICHOME BIREFRINGENCE-LIKE 2,... Lus10030590 9.7 0.8761
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Lus10035921 13.4 0.8404
AT5G63180 Pectin lyase-like superfamily ... Lus10014887 21.5 0.8111
Lus10018670 23.4 0.8400
AT1G68290 ENDO2 ,ENDO 2 endonuclease 2 (.1) Lus10034336 40.8 0.8214
AT4G37850 bHLH bHLH025 basic helix-loop-helix (bHLH) ... Lus10039640 44.6 0.8109
AT4G09890 Protein of unknown function (D... Lus10033529 46.1 0.8019
AT5G01300 PEBP (phosphatidylethanolamine... Lus10003388 61.2 0.7509
AT2G20820 unknown protein Lus10037883 68.2 0.7940
AT4G21340 bHLH bHLH103, B70 basic helix-loop-helix (bHLH) ... Lus10005959 70.1 0.7932

Lus10029197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.