Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 114 / 2e-34 SAUR-like auxin-responsive protein family (.1) AT5G18030 104 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT2G21210 104 / 9e-31 SAUR-like auxin-responsive protein family (.1) AT5G18080 104 / 1e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 103 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT5G18010 103 / 2e-30 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT5G18050 103 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT5G18020 103 / 4e-30 SAUR-like auxin-responsive protein family (.1) AT2G21200 102 / 9e-30 SAUR-like auxin-responsive protein family (.1) AT4G38825 98 / 3e-28 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010713 [exp] 156 / 6e-51 AT4G38840 111 / 2e-33 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 143 / 7e-46 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 143 / 9e-46 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 141 / 3e-45 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 140 / 7e-45 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 140 / 8e-45 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 140 / 1e-44 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 140 / 1e-44 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 139 / 2e-44 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 129 / 2e-40 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 124 / 3e-38 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 122 / 5e-38 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 121 / 3e-37 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 119 / 2e-36 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 114 / 1e-34 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 110 / 3e-33 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 108 / 2e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 107 / 9e-32 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 106 / 1e-31 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10029198 pacid=23151834 polypeptide=Lus10029198 locus=Lus10029198.g ID=Lus10029198.BGIv1.0 annot-version=v1.0 ATGGCTATTGGATTGCCTGGTAGTTTAGCCAAGCAGATTCTCCGAAGAACTGGCTCCGGATCGAGCAGAGGAACTTCGAGGTTTCAAGATGTGCCAAAGG GGTTCTTAGCAGTATACGTCGGAGGAGAAACACAGAAGAAGAGATTCATCGTGCCGGTGTCCTACTTAAGCCAGCCATCATTTCAGGATTTGTTGATGAT GGCTGAAGAGGAATTCGGATTTAATCATTCAATGGGTGGATTGACCATTCCTTGCAGTGAAGAGATTTTTGTTTCTGTTACTTCGAGCTTAAGCAGCAGA CCATGA
AA sequence Show only first row Show all	>Lus10029198 pacid=23151834 polypeptide=Lus10029198 locus=Lus10029198.g ID=Lus10029198.BGIv1.0 annot-version=v1.0 MAIGLPGSLAKQILRRTGSGSSRGTSRFQDVPKGFLAVYVGGETQKKRFIVPVSYLSQPSFQDLLMMAEEEFGFNHSMGGLTIPCSEEIFVSVTSSLSSR P

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10029198 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010714 [exp]	1.7	0.9261
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Lus10022226 [exp]	2.4	0.8846
AT1G41830		SKS6	SKU5 SIMILAR 6, SKU5-similar 6...		Lus10025107 [exp]	2.8	0.8682
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008999 [exp]	3.0	0.8986
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009620 [exp]	4.6	0.8824
AT4G34770			SAUR-like auxin-responsive pro...		Lus10025909 [exp]	5.5	0.8854
AT4G35470		PIRL4, DREB1C	plant intracellular ras group-...		Lus10035976 [exp]	5.7	0.8991
					Lus10034430 [exp]	6.9	0.8403
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008995 [exp]	11.0	0.8489
AT3G45780		RPT1, NPH1, JK2...	ROOT PHOTOTROPISM 1, NONPHOTOT...		Lus10036144 [exp]	11.1	0.8883

Compare expression of checked genes

Lus10029198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.