Lus10029199 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64950 227 / 6e-71 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 138 / 5e-37 Mitochondrial transcription termination factor family protein (.1)
AT5G07900 137 / 1e-36 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 94 / 4e-21 Mitochondrial transcription termination factor family protein (.1.2)
AT1G62010 92 / 2e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 92 / 3e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G79220 65 / 2e-11 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 65 / 2e-11 Mitochondrial transcription termination factor family protein (.1)
AT1G56380 65 / 3e-11 Mitochondrial transcription termination factor family protein (.1.2)
AT4G14605 63 / 1e-10 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028912 493 / 2e-175 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 482 / 7e-171 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10010714 213 / 4e-67 AT4G38840 117 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Lus10008688 143 / 4e-39 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 132 / 9e-35 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 119 / 6e-30 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 117 / 3e-29 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 113 / 4e-28 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 109 / 1e-26 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034700 147 / 1e-40 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 145 / 8e-40 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190400 140 / 6e-38 AT5G07900 206 / 9e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190300 137 / 7e-37 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 134 / 6e-36 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 134 / 1e-35 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 131 / 8e-35 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 129 / 9e-34 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 128 / 2e-33 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 128 / 2e-33 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10029199 pacid=23151702 polypeptide=Lus10029199 locus=Lus10029199.g ID=Lus10029199.BGIv1.0 annot-version=v1.0
ATGCTATCTCTCAAGCTACTCTCAGCTTACCGTCTCGGCAATCTACGTTCATTTCCAGGAGGAGGAGGAGGAGCTTGCTTCATTGCCTGCTTCTCTAATC
TCGCCGGAACCCCAACCACAAGAAGAACATCTCCCTTAATAGATTGCTTGATTTCCACCTTCAAATTCACCGAAACCCAAGCCGTAGCAATCGCCGCTCG
CTTCTCCCCACTCAGATCTCCTCAAAAGCCCAAAGCTTTATCCCGATTCTTCCGCGACCTAGGTCTAACGGACGACCACATCCAATCAACAGTCTCCGGA
GCACCTCAGATTCTGTTCGCGAACCTCGACCAGACCCTCAAACCCAAGATCCAGCAAATCCAGAAACTAGGGTTCGAAGGTTCTCGTCTCGGTAAGTTCC
TCTCCAAAAACCCTGGGGTTTTAACTGCTAGCTTGAATCAGAAGCTGGTTCGTCGGATTGACACTCTGCAGAAAACCGTATCTCATAAGGATTTGTCTAG
AGGCGTAGAGAAATCCGGCTGGGTGCTCTATAGGTACCCGGAATCGAGATTATTGTCGAACATTGCGTTTCTGAAGAGTTATGGCATTGTGGATTCTCAG
CTCTCGATACTGTTCAGGGTGCAGCCGAGGATTTTCTTGGCGACGGAATCTCAACTTAGGGATGTTGTTTCGAGGACTTTGGGGTTTGGGTTTTCGGTTG
GATCCAATATGTTTGTGTATGGTTTGCATACTGTCAATGGATTTAACGACATTGCAATGGAGAAGAAATTCGCAGTCTTTATTGAGTTCGGGTTTTCGAG
GGAGGAATGTAACGACATGCTCAGAAAGGCTCCTGTGTTGATGAGGCATGGTGAGGAGAAGTTGAAGTTCGGGATTGATTTCTATTTGAACACAATGAAG
CTGACGAGGGAGATGATTTGTCGTAGTCCTGCGCTGTTTATGTATATCATGAGTGAAAGAGTGATTCCGAGGTATCGTGTGTTGGAAGTTTTGGTGTCGA
AAGCACTGTTAAAGAGTAGGCCGAATTTTGGTACTGTTGCGAGCTTGACAGATGAGAGGTTTATCGAGAAGTTTGTGTTTCGGTCTGTAGATGATGCCGA
GGAACTGTTGATGGTTTACAAAGGTGCAACATGTCTATAG
AA sequence
>Lus10029199 pacid=23151702 polypeptide=Lus10029199 locus=Lus10029199.g ID=Lus10029199.BGIv1.0 annot-version=v1.0
MLSLKLLSAYRLGNLRSFPGGGGGACFIACFSNLAGTPTTRRTSPLIDCLISTFKFTETQAVAIAARFSPLRSPQKPKALSRFFRDLGLTDDHIQSTVSG
APQILFANLDQTLKPKIQQIQKLGFEGSRLGKFLSKNPGVLTASLNQKLVRRIDTLQKTVSHKDLSRGVEKSGWVLYRYPESRLLSNIAFLKSYGIVDSQ
LSILFRVQPRIFLATESQLRDVVSRTLGFGFSVGSNMFVYGLHTVNGFNDIAMEKKFAVFIEFGFSREECNDMLRKAPVLMRHGEEKLKFGIDFYLNTMK
LTREMICRSPALFMYIMSERVIPRYRVLEVLVSKALLKSRPNFGTVASLTDERFIEKFVFRSVDDAEELLMVYKGATCL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64950 Mitochondrial transcription te... Lus10029199 0 1
AT3G02530 TCP-1/cpn60 chaperonin family ... Lus10017585 3.3 0.9236
AT5G26360 TCP-1/cpn60 chaperonin family ... Lus10017853 4.9 0.9186
AT1G26460 Tetratricopeptide repeat (TPR)... Lus10004649 9.8 0.9005
AT1G54610 Protein kinase superfamily pro... Lus10033975 9.8 0.8960
AT2G05920 Subtilase family protein (.1) Lus10033431 17.3 0.8723
AT5G19320 RANGAP2 RAN GTPase activating protein ... Lus10034066 17.5 0.8824
AT2G04865 Aminotransferase-like, plant m... Lus10001163 18.3 0.8589
AT4G20980 Eukaryotic translation initiat... Lus10015435 18.7 0.8721
AT3G13920 RH4, TIF4A1, EI... eukaryotic translation initiat... Lus10021583 21.0 0.8645
AT3G03960 TCP-1/cpn60 chaperonin family ... Lus10007430 23.1 0.8757

Lus10029199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.