Lus10029201 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1)
AT5G47000 278 / 7e-94 Peroxidase superfamily protein (.1)
AT3G28200 271 / 2e-91 Peroxidase superfamily protein (.1)
AT5G40150 267 / 1e-89 Peroxidase superfamily protein (.1)
AT4G17690 264 / 2e-88 Peroxidase superfamily protein (.1)
AT2G18980 202 / 2e-64 Peroxidase superfamily protein (.1)
AT5G14130 201 / 1e-63 Peroxidase superfamily protein (.1)
AT4G37530 199 / 8e-63 Peroxidase superfamily protein (.1.2)
AT4G30170 194 / 3e-61 Peroxidase family protein (.1)
AT4G37520 194 / 4e-61 Peroxidase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010716 470 / 2e-169 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10004234 305 / 3e-104 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10042144 304 / 5e-104 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10039445 284 / 4e-96 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10039471 240 / 7e-81 AT5G40150 290 / 2e-99 Peroxidase superfamily protein (.1)
Lus10014517 237 / 1e-79 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10032170 236 / 2e-79 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10011079 204 / 2e-64 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10012540 199 / 1e-62 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G036100 362 / 6e-127 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.012G076500 315 / 1e-108 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.001G351000 279 / 2e-94 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.007G074700 233 / 4e-76 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.004G052100 213 / 6e-68 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.007G053400 210 / 3e-67 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.001G329200 210 / 3e-67 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.017G064100 208 / 2e-66 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.018G089900 202 / 3e-64 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.011G062300 192 / 8e-60 AT2G34060 434 / 1e-152 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10029201 pacid=23151818 polypeptide=Lus10029201 locus=Lus10029201.g ID=Lus10029201.BGIv1.0 annot-version=v1.0
ATGGTGGTCCGTTCCAAGACCGAGTTGGAGCTCGAATGCCCGAATGTGATCTCGTGTGCGGACATTCTATCCGTGGCAACTCGCAACCTTGTCACAATGG
TTGGTGGACCGTTCTATCCGGTCCGCCTTGGCCGGAAGGACGGCATGGTTTCAGACCCTTCCCGGGTGGAGCCCAACATACTCCGCCCCACAATGTCAAT
CTCTCAGATCATCGGATTCTTTGTTTCGAGAGGGTTCACGGTTCAAGAAATGGTAACATTGATGGGAGCGCATACGATCGGGTTCTCACATTGTAGAGAG
TTTGCTAATCGGCTTTACAATTTCAGCAAGGAAACCCCTACAGATCCTTCACTCAACCCGAAATTTGCAGACGGGCTGAAGAAACTGTGCGAAAACTATA
CGAAGGACCCAACAATGAGCGCATTCAACGACGTGATGACCCCTGGGAAATTTGACAACATGTATTACCAAAATCTGGAGAAAGGTTTGGGATTGCTTTC
GTCGGATGAAGCTATGTACATGGATCAGAGAACGAAGCCTTTCGTCAACCTTTATGCAAAGAATGAGTCGGCCTTCTTCCAAGCGTTTGCTCAAGCGATG
GAGAAGGTCAGTAACTACAAGGTCAAGACAGGGAAAGATGGAGAGATCAGACATAGGTGCGACCAGATCAACACTGTAAAAATTTAA
AA sequence
>Lus10029201 pacid=23151818 polypeptide=Lus10029201 locus=Lus10029201.g ID=Lus10029201.BGIv1.0 annot-version=v1.0
MVVRSKTELELECPNVISCADILSVATRNLVTMVGGPFYPVRLGRKDGMVSDPSRVEPNILRPTMSISQIIGFFVSRGFTVQEMVTLMGAHTIGFSHCRE
FANRLYNFSKETPTDPSLNPKFADGLKKLCENYTKDPTMSAFNDVMTPGKFDNMYYQNLEKGLGLLSSDEAMYMDQRTKPFVNLYAKNESAFFQAFAQAM
EKVSNYKVKTGKDGEIRHRCDQINTVKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24110 Peroxidase superfamily protein... Lus10029201 0 1
AT5G17680 disease resistance protein (TI... Lus10041060 3.3 0.8450
AT3G21070 NADK1, ATNADK-1 NAD kinase 1 (.1.2) Lus10003178 4.9 0.8057
AT5G63800 MUM2, BGAL6 MUCILAGE-MODIFIED 2, beta-gala... Lus10033500 7.5 0.8011
AT1G24110 Peroxidase superfamily protein... Lus10010716 12.0 0.7719
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10029900 12.4 0.8018
AT5G41650 Lactoylglutathione lyase / gly... Lus10024719 14.3 0.7068
AT5G16920 Fasciclin-like arabinogalactan... Lus10039146 14.3 0.7486
AT5G10190 Major facilitator superfamily ... Lus10027265 16.0 0.7553
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10031748 17.7 0.7719
AT3G12580 ATHSP70, HSP70 ARABIDOPSIS HEAT SHOCK PROTEIN... Lus10023419 17.9 0.7792

Lus10029201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.