Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58630 74 / 4e-17 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G11100 68 / 4e-15 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G14180 68 / 1e-14 Trihelix ASIL2 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) AT5G05550 67 / 1e-14 Trihelix sequence-specific DNA binding transcription factors (.1.2) AT1G54060 52 / 4e-09 Trihelix ASIL1 6B-interacting protein 1-like 1 (.1) AT3G24490 49 / 9e-08 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007273 [exp] 145 / 2e-44 AT3G14180 200 / 4e-62 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10015281 [exp] 108 / 1e-31 AT3G58630 79 / 2e-18 sequence-specific DNA binding transcription factors (.1) Lus10025404 [exp] 110 / 8e-31 AT3G14180 197 / 1e-61 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10025406 [exp] 109 / 1e-30 AT3G14180 202 / 3e-63 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10028985 [exp] 63 / 7e-14 AT5G05550 95 / 1e-24 sequence-specific DNA binding transcription factors (.1.2) Lus10013179 [exp] 58 / 5e-11 AT3G14180 256 / 5e-81 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10029889 [exp] 57 / 8e-11 AT3G14180 147 / 1e-40 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10025772 [exp] 56 / 2e-10 AT3G24490 223 / 3e-70 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10008141 [exp] 56 / 4e-10 AT3G14180 271 / 3e-87 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G118600 [exp] 117 / 9e-34 AT3G58630 139 / 5e-39 sequence-specific DNA binding transcription factors (.1) Potri.001G113600 [exp] 114 / 2e-32 AT3G58630 138 / 1e-38 sequence-specific DNA binding transcription factors (.1) Potri.008G071300 [exp] 71 / 5e-16 AT5G05550 209 / 3e-67 sequence-specific DNA binding transcription factors (.1.2) Potri.001G026000 [exp] 68 / 1e-14 AT3G14180 186 / 1e-54 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.010G186200 [exp] 63 / 3e-13 AT5G05550 149 / 3e-44 sequence-specific DNA binding transcription factors (.1.2) Potri.T126206 [exp] 63 / 8e-13 AT3G14180 173 / 9e-50 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.003G200000 [exp] 63 / 8e-13 AT3G14180 172 / 2e-49 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.001G179800 [exp] 52 / 6e-09 AT3G24490 206 / 2e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.003G056000 [exp] 51 / 1e-08 AT3G24490 205 / 8e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.018G075500 [exp] 50 / 2e-08 AT3G24490 252 / 1e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029220 pacid=23139921 polypeptide=Lus10029220 locus=Lus10029220.g ID=Lus10029220.BGIv1.0 annot-version=v1.0 ATGGCTGCTCAAGCTGCTGCGGCGGCGGCTGCTGAATCGGAGAGTGAGGAGGAGGAGATGGAAATGGAGAATGAGAAGGATGAGGAAGGTGAAGGTGTGA GGAGGTTGGCTAGAGCTATTGAGAGGTTTGGTGATGTTTACGAGAGAGTTGAAGGGGAGAAGTTGAGGCAGATGATTGATCTGGAGAAGCAGAGGATGAA GTTTGCTAAAGATTTGGAGATGGAGAGGATGAGGATCTTCACTGAGACTCAGATCCAGCTCGAGAGGATCAAGAAAGGGAAGCGTTCTAATGGTGAGAGG GATTATTGA
AA sequence Show only first row Show all	>Lus10029220 pacid=23139921 polypeptide=Lus10029220 locus=Lus10029220.g ID=Lus10029220.BGIv1.0 annot-version=v1.0 MAAQAAAAAAAESESEEEEMEMENEKDEEGEGVRRLARAIERFGDVYERVEGEKLRQMIDLEKQRMKFAKDLEMERMRIFTETQIQLERIKKGKRSNGER DY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10029220 [exp]	0	1
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10007273 [exp]	1.0	0.9347
AT5G37370		ATSRL1	PRP38 family protein (.1.2.3.4...		Lus10015203 [exp]	3.7	0.9163
AT2G25670			unknown protein		Lus10017738 [exp]	8.5	0.9154
AT2G03190		ASK16	SKP1-like 16 (.1)		Lus10031747 [exp]	8.9	0.9047
AT5G14440			Surfeit locus protein 2 (SURF2...		Lus10022288 [exp]	9.8	0.8918
AT1G07890		ATAPX01, CS1, A...	maternal effect embryo arrest ...		Lus10013537 [exp]	11.0	0.9090
AT3G56490		HIT3, HINT1	HISTIDINE TRIAD NUCLEOTIDE-BIN...		Lus10035409 [exp]	11.2	0.9036
AT5G53800			unknown protein		Lus10014800 [exp]	11.7	0.9025
AT5G49210			unknown protein		Lus10032604 [exp]	11.8	0.9025
AT3G56490		HIT3, HINT1	HISTIDINE TRIAD NUCLEOTIDE-BIN...		Lus10031011 [exp]	13.8	0.9012

Compare expression of checked genes

Lus10029220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.