Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40330 182 / 4e-58 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G45860 176 / 7e-57 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1) AT5G45870 168 / 2e-53 RCAR6, PYL12 regulatory components of ABA receptor 6, PYR1-like 12 (.1) AT2G38310 164 / 2e-51 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT5G05440 160 / 8e-50 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G01360 158 / 2e-49 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT5G53160 158 / 3e-49 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G01026 157 / 2e-48 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT4G17870 154 / 1e-47 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G26040 151 / 2e-46 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007275 [exp] 368 / 5e-132 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10014239 [exp] 193 / 9e-63 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 190 / 2e-60 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 172 / 2e-54 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 160 / 1e-50 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10026430 [exp] 161 / 5e-50 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10024991 [exp] 159 / 3e-49 AT2G26040 264 / 7e-91 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10001059 [exp] 151 / 2e-46 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 149 / 1e-45 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104100 [exp] 191 / 6e-62 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.016G125400 [exp] 188 / 9e-61 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 169 / 2e-53 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.018G054400 [exp] 167 / 7e-53 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.008G073400 [exp] 166 / 6e-52 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G230600 [exp] 162 / 1e-50 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.002G169400 [exp] 161 / 2e-50 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.001G142500 [exp] 161 / 3e-50 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.014G097100 [exp] 160 / 7e-50 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.003G091700 [exp] 159 / 2e-49 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10029222 pacid=23139963 polypeptide=Lus10029222 locus=Lus10029222.g ID=Lus10029222.BGIv1.0 annot-version=v1.0 ATGCATACTCGTCTACACACCAGCAACCACCGGTCTTCGACTGATCACCAGTCAACTAGGTGGTCAGCCAAGACCAGAGCCATGATGAGCCGATTCCACC AGCCGGCTCTATCACCGAACCAGTGCGGCTCCCACATCATCCAAGTCATCGACGCGCCCTTACACCTAGTGTGGTCCGTCATTCGAAAATTCGATTCCCC GCAGGCTTACAAAGGTTTCATCAAAAGCTGTGACTTGATCCACGGCGACGGTGGAGTGGGGAGCGTCAGGGAGGTGAGGCTGGTCTCCGGCTTGCCGGCG AATGTTAGTCAGGAGCGGCTGGACCGGCTCGACGACGAGGGGAAAGTGATGGTGGTTAGTAACATTGGTGGGGACCACAAGCTTGTTAACTATAGAGCTA CGACGACTTTGCATGATGATGGGGAAGGTGGGGAGGGGAAGAGGTCGGTGGTGATTGAGTCGTACGTTGTGGATATTCCGACGGATAGTTCGCCGGAGGA CACGTGTTCGTTTGCTGACACGATTATTGGGTGCAACTTGAAGTCGCTCGCTAGGATTGCTGAGAAAATGACGCATTGA
AA sequence Show only first row Show all	>Lus10029222 pacid=23139963 polypeptide=Lus10029222 locus=Lus10029222.g ID=Lus10029222.BGIv1.0 annot-version=v1.0 MHTRLHTSNHRSSTDHQSTRWSAKTRAMMSRFHQPALSPNQCGSHIIQVIDAPLHLVWSVIRKFDSPQAYKGFIKSCDLIHGDGGVGSVREVRLVSGLPA NVSQERLDRLDDEGKVMVVSNIGGDHKLVNYRATTTLHDDGEGGEGKRSVVIESYVVDIPTDSSPEDTCSFADTIIGCNLKSLARIAEKMTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40330		RCAR9, PYL6	regulatory components of ABA r...		Lus10029222 [exp]	0	1
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Lus10013185 [exp]	1.4	0.9122
AT5G25500			unknown protein		Lus10002031 [exp]	2.8	0.9102
AT2G40940		ERS1	ethylene response sensor 1 (.1...		Lus10010310 [exp]	3.0	0.9060
AT4G19460			UDP-Glycosyltransferase superf...		Lus10033297 [exp]	3.5	0.8910
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Lus10036088 [exp]	5.9	0.8821
AT2G40330		RCAR9, PYL6	regulatory components of ABA r...		Lus10007275 [exp]	6.9	0.8758
AT1G55890			Tetratricopeptide repeat (TPR)...		Lus10020073 [exp]	7.9	0.8717
AT1G58330		ZW2	transcription factor-related (...		Lus10005041 [exp]	9.4	0.8706
AT2G33410			RNA-binding (RRM/RBD/RNP motif...		Lus10043124 [exp]	10.8	0.8603
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10038282 [exp]	11.5	0.8493

Compare expression of checked genes

Lus10029222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.