Lus10029224 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007278 50 / 4e-08 AT1G14650 512 / 3e-174 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10013966 46 / 1e-06 AT1G14650 672 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029224 pacid=23139802 polypeptide=Lus10029224 locus=Lus10029224.g ID=Lus10029224.BGIv1.0 annot-version=v1.0
ATGGGTGGTGGATATCCTGTCCCTCTGCCAAAGCCACTAGGTATGCCATTGATGCCATCAATTCGTCCACCAAACATGCCTGCGGTACCACCTCCACCAG
GGTCTCAGTTTTATCCCACGCCAATGCACCGTCCTTTTGCCCCTGTGCCTATTATGTCTATGCCTCCACCACACACGCATGCTATGGCCCCTCCTCCACC
CTTACCTCAGGGAGTGCCTCCACCACCACCTCCTCCTGAAGAATATGATTCAATGCTTATTCCAGAAGAGCAGTTTTTGGCCCAGCATCCTATGCGGAGC
CTTGGGGAACAAGCAACTGAGGGCGGTAGAGCAACTGTTCCTTTGGGTTAG
AA sequence
>Lus10029224 pacid=23139802 polypeptide=Lus10029224 locus=Lus10029224.g ID=Lus10029224.BGIv1.0 annot-version=v1.0
MGGGYPVPLPKPLGMPLMPSIRPPNMPAVPPPPGSQFYPTPMHRPFAPVPIMSMPPPHTHAMAPPPPLPQGVPPPPPPPEEYDSMLIPEEQFLAQHPMRS
LGEQATEGGRATVPLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029224 0 1
AT2G28380 DRB2 dsRNA-binding protein 2 (.1) Lus10041311 6.5 0.7012
AT1G03590 Protein phosphatase 2C family ... Lus10031631 9.1 0.7699
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10033044 10.0 0.7283
AT1G67080 ABA4 abscisic acid (aba)-deficient ... Lus10028476 16.9 0.7359
AT5G17620 unknown protein Lus10013643 17.3 0.7514
AT1G56310 Polynucleotidyl transferase, r... Lus10031404 17.9 0.7238
AT3G24150 unknown protein Lus10019404 21.2 0.7425
AT5G23190 CYP86B1 "cytochrome P450, family 86, s... Lus10040986 30.0 0.6980
AT3G05870 APC11 anaphase-promoting complex/cyc... Lus10015126 31.2 0.7446
AT1G06980 unknown protein Lus10036859 32.4 0.7295

Lus10029224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.