Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 71 / 4e-17 LTP3 lipid transfer protein 3 (.1) AT5G59310 71 / 4e-17 LTP4 lipid transfer protein 4 (.1) AT3G51590 68 / 1e-15 LTP12 lipid transfer protein 12 (.1) AT4G33355 66 / 8e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G08770 65 / 1e-14 LTP6 lipid transfer protein 6 (.1.2) AT2G38530 63 / 1e-13 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G38540 62 / 1e-13 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G15050 60 / 1e-12 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G01870 59 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 59 / 5e-12 LTP5 lipid transfer protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007280 [exp] 142 / 4e-45 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10015278 [exp] 88 / 9e-24 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10015279 [exp] 87 / 4e-23 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10014167 [exp] 76 / 9e-19 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 73 / 2e-17 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025234 [exp] 70 / 2e-16 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10025231 [exp] 70 / 3e-16 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10025230 [exp] 70 / 4e-16 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10025148 [exp] 69 / 7e-16 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 79 / 6e-20 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 76 / 1e-18 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 73 / 1e-17 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 69 / 2e-16 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 62 / 2e-13 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G135500 [exp] 58 / 5e-12 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135700 [exp] 56 / 3e-11 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.014G046500 [exp] 54 / 2e-10 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G108100 [exp] 54 / 3e-10 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 50 / 7e-09 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10029226 pacid=23139955 polypeptide=Lus10029226 locus=Lus10029226.g ID=Lus10029226.BGIv1.0 annot-version=v1.0 ATGGCCGCCGCAAACTATAAGCTGCAGGTTGCTTGCGTGGCGGCGGCGCTCACGGCGGCTATATTGGTGTCGAGTTCGCACGGCGCGGTGACTTGCGGCC AAGTGACGTCGACCGTGGCTCCGTGCTTCGGCTACATCACAGGGAGTGGGCCGCTGGTTCCGGGATGTTGCAACGGGGTCAGATCCCTTAACGGTGCCGC CAAAAACACGCCTGACAGGCAAGCTACCTGCCGATGCCTGAAGACCCTCGTCGGAGGTGCCCCGGGGATCAATTTGGGTCTCCTCGGTGGGATTCCAGGG AAGTGTCACGTCAATGTTCCCGGCCCATTCAACCCATCCGTTGACTGCAACAAGTGA
AA sequence Show only first row Show all	>Lus10029226 pacid=23139955 polypeptide=Lus10029226 locus=Lus10029226.g ID=Lus10029226.BGIv1.0 annot-version=v1.0 MAAANYKLQVACVAAALTAAILVSSSHGAVTCGQVTSTVAPCFGYITGSGPLVPGCCNGVRSLNGAAKNTPDRQATCRCLKTLVGGAPGINLGLLGGIPG KCHVNVPGPFNPSVDCNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10029226 [exp]	0	1
AT4G09960	MADS	AGL11, STK	SEEDSTICK, AGAMOUS-like 11, K-...		Lus10008264 [exp]	1.7	0.9312
AT5G19530		ACL5	ACAULIS 5, S-adenosyl-L-methio...		Lus10000469 [exp]	2.0	0.9348
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10036075 [exp]	2.6	0.9155
AT5G65010		ASN2	asparagine synthetase 2 (.1.2)		Lus10031300 [exp]	3.5	0.9054
AT3G20640	bHLH	bHLH123	basic helix-loop-helix (bHLH) ...		Lus10029460 [exp]	4.7	0.8927
AT2G21400		SRS3	SHI-related sequence3 (.1)		Lus10017492 [exp]	7.6	0.8861
AT1G47530			MATE efflux family protein (.1...		Lus10002367 [exp]	10.0	0.8894
AT3G26380			Melibiase family protein (.1)		Lus10011407 [exp]	10.4	0.9320
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Lus10030616 [exp]	15.0	0.8996
AT4G37980		ELI3-1, ATCAD7	CINNAMYL-ALCOHOL DEHYDROGENASE...		Lus10023268 [exp]	17.5	0.9160

Compare expression of checked genes

Lus10029226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.