Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18100 52 / 3e-09 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G62040 44 / 2e-06 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT4G20370 44 / 3e-06 TSF TWIN SISTER OF FT, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT2G27550 42 / 8e-06 ATC centroradialis (.1) AT5G03840 41 / 3e-05 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002592 [exp] 113 / 5e-33 AT1G18100 207 / 6e-69 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10018417 [exp] 112 / 2e-32 AT1G18100 205 / 4e-68 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10021372 [exp] 54 / 8e-10 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10027442 [exp] 53 / 1e-09 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10005753 [exp] 53 / 2e-09 AT5G62040 241 / 5e-82 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10004886 [exp] 47 / 1e-07 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10043385 [exp] 45 / 1e-06 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10019541 [exp] 42 / 7e-06 AT2G27550 188 / 5e-62 centroradialis (.1) Lus10004884 [exp] 41 / 4e-05 AT2G27550 218 / 3e-73 centroradialis (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G203900 [exp] 49 / 3e-08 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.015G041000 [exp] 49 / 3e-08 AT1G18100 291 / 2e-102 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029233 pacid=23139831 polypeptide=Lus10029233 locus=Lus10029233.g ID=Lus10029233.BGIv1.0 annot-version=v1.0 ATGAGGCAAACAGTGTGCCGCTTGATTAGCTTCTTTAAAGATCCAGCTCATGATATCACAACAATCTTCAAATTCGAGAATATCTGCACAGGGGAAGAGG TGGAGCTACATGGGGCCGCAGCCGCCGACGGGATACCCAGGTACGTTATGGCGCTGTTCCGGCAGGAGAGGTCGCTGGTGGGGAGGATGTGCCTGGTTGC GCCCGAAATGCACGGGAATTTCTGCACGCACCACTTCGCTGCGTGTAACGGACTCGGCCTGCATGTGCCCGCCGTCTATTTTAACTCCCGCAAGGAGCCC GCCGTTAAGAAACAATAG
AA sequence Show only first row Show all	>Lus10029233 pacid=23139831 polypeptide=Lus10029233 locus=Lus10029233.g ID=Lus10029233.BGIv1.0 annot-version=v1.0 MRQTVCRLISFFKDPAHDITTIFKFENICTGEEVELHGAAAADGIPRYVMALFRQERSLVGRMCLVAPEMHGNFCTHHFAACNGLGLHVPAVYFNSRKEP AVKKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10029233 [exp]	0	1
AT1G69210			Uncharacterised protein family...		Lus10014566 [exp]	1.0	0.8475
AT5G42290			transcription activator-relate...		Lus10021820 [exp]	11.8	0.7663
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10037090 [exp]	12.0	0.6777
AT2G43610			Chitinase family protein (.1)		Lus10003586 [exp]	13.5	0.7985
					Lus10023763 [exp]	14.5	0.7788
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10019178 [exp]	16.5	0.6723
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Lus10027870 [exp]	20.7	0.7648
AT2G35740		ATINT3	nositol transporter 3 (.1)		Lus10017559 [exp]	24.1	0.7549
AT4G20830			FAD-binding Berberine family p...		Lus10009356 [exp]	42.3	0.7220
					Lus10018627 [exp]	44.5	0.7400

Compare expression of checked genes

Lus10029233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.