Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29290 58 / 3e-12 unknown protein AT1G16950 37 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007309 [exp] 119 / 3e-36 AT1G29290 62 / 8e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G061300 [exp] 82 / 1e-21 AT1G29290 71 / 3e-17 unknown protein Potri.011G070500 [exp] 54 / 2e-10 AT1G29290 42 / 7e-06 unknown protein Potri.001G393101 [exp] 41 / 6e-06 AT1G29290 45 / 1e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029256 pacid=23139795 polypeptide=Lus10029256 locus=Lus10029256.g ID=Lus10029256.BGIv1.0 annot-version=v1.0 ATGGCTCATCGTGCTCATTCCGCCACCCTCTTGATTCTACTATCCCTCCTCTCAGTTTCCCTCTTCCTAAACGGTGCTGAATCCAGAAAGCTATTGTCGG ACGGTGGAGATAACAAAGACGCCGCCGTTTCATCTCTGTTCCAGAGCTTGCTACTGATGAGCTCTCTTCCGAAGGGAACCGTTCCGGCTTCTTCGCCGAG CAAGAAGGGCCATTCGTCGGTGGATAATGTGGGTCGTTTTGAGAGGCATCTGGCGAGTATTGATCGGATTCTACGATCTGTTCCCAGCCCTGGAATGGGT CATTAG
AA sequence Show only first row Show all	>Lus10029256 pacid=23139795 polypeptide=Lus10029256 locus=Lus10029256.g ID=Lus10029256.BGIv1.0 annot-version=v1.0 MAHRAHSATLLILLSLLSVSLFLNGAESRKLLSDGGDNKDAAVSSLFQSLLLMSSLPKGTVPASSPSKKGHSSVDNVGRFERHLASIDRILRSVPSPGMG H

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29290			unknown protein		Lus10029256 [exp]	0	1
AT3G15518			unknown protein		Lus10037893 [exp]	1.4	0.9109
AT1G76600			unknown protein		Lus10037249 [exp]	1.7	0.9137
AT3G55430			O-Glycosyl hydrolases family 1...		Lus10040294 [exp]	3.0	0.8900
AT4G11070	WRKY	ATWRKY41, WRKY4...	WRKY family transcription fact...		Lus10039331 [exp]	3.2	0.8782
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10021263 [exp]	4.0	0.8824
AT1G21010			unknown protein		Lus10035664 [exp]	4.6	0.8684
AT1G70420			Protein of unknown function (D...		Lus10029153 [exp]	6.0	0.8691
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10015998 [exp]	7.4	0.8469
AT1G34300			lectin protein kinase family p...		Lus10013252 [exp]	7.5	0.8670
AT3G59080			Eukaryotic aspartyl protease f...		Lus10020759 [exp]	9.8	0.8236

Compare expression of checked genes

Lus10029256 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.