Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53400 165 / 3e-54 Ubiquitin domain-containing protein (.1) AT5G45740 150 / 3e-48 Ubiquitin domain-containing protein (.1) AT1G16960 138 / 1e-43 Ubiquitin domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007315 [exp] 200 / 4e-68 AT1G53400 194 / 8e-66 Ubiquitin domain-containing protein (.1) Lus10015233 [exp] 185 / 4e-62 AT1G53400 199 / 1e-67 Ubiquitin domain-containing protein (.1) Lus10005423 [exp] 151 / 7e-49 AT1G53400 165 / 2e-54 Ubiquitin domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G387400 [exp] 166 / 1e-54 AT1G53400 182 / 4e-61 Ubiquitin domain-containing protein (.1) Potri.011G107700 [exp] 157 / 5e-51 AT1G53400 172 / 2e-56 Ubiquitin domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029264 pacid=23139799 polypeptide=Lus10029264 locus=Lus10029264.g ID=Lus10029264.BGIv1.0 annot-version=v1.0 ATGGGTTGCGCCGGATCCTCCTTCGGCAAGGCAGATGGAGGCAATAAGCAGGTGAGGAAGCCAAAGGCATGGAAGCATTCAGAGCCGATCACAAGGGCAC AGCTCGTTAGGATGCGTGACGAGTTCTGGGACACTGCTCCTCACTATGGTGGCCGCAAAGAGATATGGGATGCACTCCGTGCAGCTGCAGAAGCTAATGT GGAACTTGCTCAGGCGATCGTGGACAGTGCAGGCGTCATTTTGCAGAGTGAGGACATGACGATTTGCTACGACGAGAGAGGCGCCAAGTATGAACTCCCA AAGTATGTGTTGAGCGAGCCATCCAATTTGATCAGTAACGACTGA
AA sequence Show only first row Show all	>Lus10029264 pacid=23139799 polypeptide=Lus10029264 locus=Lus10029264.g ID=Lus10029264.BGIv1.0 annot-version=v1.0 MGCAGSSFGKADGGNKQVRKPKAWKHSEPITRAQLVRMRDEFWDTAPHYGGRKEIWDALRAAAEANVELAQAIVDSAGVILQSEDMTICYDERGAKYELP KYVLSEPSNLISND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53400			Ubiquitin domain-containing pr...		Lus10029264 [exp]	0	1
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10024263 [exp]	4.5	0.9012
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10014163 [exp]	6.2	0.8936
AT1G53400			Ubiquitin domain-containing pr...		Lus10007315 [exp]	6.2	0.8509
AT3G28180		ATCSLC4, CSLC4,...	CELLULOSE-SYNTHASE LIKE C4, Ce...		Lus10039475 [exp]	7.3	0.8549
AT1G70670		AtCLO4	Arabidopsis thaliana caleosin ...		Lus10041446 [exp]	7.7	0.8717
AT5G48290			Heavy metal transport/detoxifi...		Lus10025181 [exp]	9.9	0.8840
AT5G54380		THE1	THESEUS1, protein kinase famil...		Lus10037887 [exp]	10.5	0.8344
AT3G19680			Protein of unknown function (D...		Lus10020509 [exp]	10.9	0.8614
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	11.0	0.8653
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10007348 [exp]	11.6	0.8656

Compare expression of checked genes

Lus10029264 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.