Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G062700 [exp] 79 / 2e-20 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029272 pacid=23139822 polypeptide=Lus10029272 locus=Lus10029272.g ID=Lus10029272.BGIv1.0 annot-version=v1.0 ATGCGGCTCCCAATCAACCACTCCTTCGTCGCTACCTTGCTGCTCTTCATCCTCCTACTTCTTCCGTCGCCTTCCTCGCCGTCGCCTTATCCAGACCGGA GATTGTCATCCAACCGCCAGATGGTAAATTGCAGCGGCATGGTGTCCAGATCTCAGTGCTCCCAGAACCCAAAATGCAGGTGGTGCCGTAGTGAAGCTGT TGACGACACGTGCTTCAGAAAGATCGACGCTTGGCGGCTCCCTCACCAGGTCTTTGTCTGCGATTGA
AA sequence Show only first row Show all	>Lus10029272 pacid=23139822 polypeptide=Lus10029272 locus=Lus10029272.g ID=Lus10029272.BGIv1.0 annot-version=v1.0 MRLPINHSFVATLLLFILLLLPSPSSPSPYPDRRLSSNRQMVNCSGMVSRSQCSQNPKCRWCRSEAVDDTCFRKIDAWRLPHQVFVCD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029272 [exp]	0	1
AT4G38660			Pathogenesis-related thaumatin...		Lus10025055 [exp]	1.0	0.9196
AT5G38300			unknown protein		Lus10033566 [exp]	1.7	0.8595
AT5G55730		FLA1	FASCICLIN-like arabinogalactan...		Lus10022517 [exp]	2.4	0.8731
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10026662 [exp]	7.1	0.8336
AT3G63170			Chalcone-flavanone isomerase f...		Lus10022046 [exp]	7.4	0.8322
AT3G61580		AtSLD1	sphingoid LCB desaturase 1, Fa...		Lus10035482 [exp]	8.5	0.8592
AT2G15290		ATTIC21, TIC21,...	PERMEASE IN CHLOROPLASTS 1, CH...		Lus10019814 [exp]	9.7	0.8523
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10008400 [exp]	12.7	0.8505
AT5G46700		TRN2, TET1	TORNADO 2, TETRASPANIN 1, Tetr...		Lus10017336 [exp]	14.5	0.8077
AT3G17350			unknown protein		Lus10043098 [exp]	15.4	0.8067

Compare expression of checked genes

Lus10029272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.