Lus10029283 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12120 266 / 8e-90 FAD2 fatty acid desaturase 2 (.1.2)
AT3G11170 103 / 2e-26 AtFAD7, FADD, FAD7 FATTY ACID DESATURASE D, fatty acid desaturase 7 (.1)
AT5G05580 100 / 2e-25 AtFAD8, SH1, FAD8 fatty acid desaturase 8 (.1.2)
AT2G29980 98 / 1e-24 AtFAD3, FAD3 fatty acid desaturase 3 (.1.2)
AT4G30950 45 / 1e-05 FADC, SFD4, FAD6 STEAROYL DESATURASE DEFICIENCY 4, FATTY ACID DESATURASE C, fatty acid desaturase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012007 336 / 2e-120 AT3G12120 266 / 8e-90 fatty acid desaturase 2 (.1.2)
Lus10004175 300 / 6e-103 AT3G12120 635 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021051 299 / 2e-102 AT3G12120 634 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021048 244 / 6e-84 AT3G12120 246 / 2e-81 fatty acid desaturase 2 (.1.2)
Lus10004178 242 / 6e-80 AT3G12120 532 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004176 235 / 2e-77 AT3G12120 519 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021050 234 / 5e-77 AT3G12120 521 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004177 226 / 8e-74 AT3G12120 508 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021049 223 / 1e-72 AT3G12120 503 / 4e-179 fatty acid desaturase 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G046200 273 / 3e-92 AT3G12120 624 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012401 263 / 8e-88 AT3G12120 571 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.006G192000 256 / 2e-85 AT3G12120 629 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012700 250 / 3e-83 AT3G12120 553 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012500 203 / 1e-65 AT3G12120 480 / 3e-171 fatty acid desaturase 2 (.1.2)
Potri.001G252900 103 / 1e-26 AT2G29980 539 / 0.0 fatty acid desaturase 3 (.1.2)
Potri.008G069600 102 / 5e-26 AT5G05580 689 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.010G187800 101 / 1e-25 AT5G05580 683 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.016G117500 100 / 2e-25 AT5G05580 592 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.006G101500 100 / 5e-25 AT5G05580 632 / 0.0 fatty acid desaturase 8 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00487 FA_desaturase Fatty acid desaturase
Representative CDS sequence
>Lus10029283 pacid=23139976 polypeptide=Lus10029283 locus=Lus10029283.g ID=Lus10029283.BGIv1.0 annot-version=v1.0
ATGGAGATATACCTATCCGACGCAGGGATATTCACCGTGTGCTACATCCTATACAGACTCGTCCTCACGAAAGGACTCGTTTGGGTCGTGTCCATTTACG
GAGTCCCACTATTGATAGTGAATGGATTCCTAGTCCTCATCACTTTCTTGCAGCACACGCATCCTTCTCTTCCGCACTACAAGTCCTCCGAATGGGACTG
GCTGCGAGGCGCCCTCTCGACCGTGGATCGAGACTACGGGTTACTCAACACCGTGTTCCACAACATCACCGATACACATGTCGCGCACCATCTCTTCTCC
ACGATGCCTCATTACCACGCGATGGAGGCTACCAAGGCGATCAAGCCGGTTCTCGGGGAGTATTACCAGTTCGATGGGACTCCCTTTGTGAAGGCCATGT
GGAGGGAGGCAAAGGAGTGCATCTATGTCGAGCCGGATGAAGGCGACCCCAGCCAAGGCGTGTTCTGGTACAACAACAAGCTGTGA
AA sequence
>Lus10029283 pacid=23139976 polypeptide=Lus10029283 locus=Lus10029283.g ID=Lus10029283.BGIv1.0 annot-version=v1.0
MEIYLSDAGIFTVCYILYRLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSEWDWLRGALSTVDRDYGLLNTVFHNITDTHVAHHLFS
TMPHYHAMEATKAIKPVLGEYYQFDGTPFVKAMWREAKECIYVEPDEGDPSQGVFWYNNKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10029283 0 1
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10012007 1.0 0.9679
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10012008 2.0 0.8195
AT2G18245 alpha/beta-Hydrolases superfam... Lus10028314 8.7 0.6926
AT2G16890 UDP-Glycosyltransferase superf... Lus10022220 13.1 0.7098
AT2G15290 ATTIC21, TIC21,... PERMEASE IN CHLOROPLASTS 1, CH... Lus10014100 15.0 0.7270
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10012974 15.9 0.7134
AT2G33250 unknown protein Lus10023703 20.1 0.7199
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10029284 21.9 0.7195
AT5G08370 ATAGAL2 alpha-galactosidase 2 (.1.2) Lus10036176 23.5 0.7105
AT3G07470 Protein of unknown function, D... Lus10025861 27.5 0.6796

Lus10029283 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.