Lus10029284 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12120 244 / 3e-81 FAD2 fatty acid desaturase 2 (.1.2)
AT2G29980 106 / 2e-28 AtFAD3, FAD3 fatty acid desaturase 3 (.1.2)
AT5G05580 104 / 5e-27 AtFAD8, SH1, FAD8 fatty acid desaturase 8 (.1.2)
AT3G11170 103 / 1e-26 AtFAD7, FADD, FAD7 FATTY ACID DESATURASE D, fatty acid desaturase 7 (.1)
AT4G30950 64 / 1e-12 FADC, SFD4, FAD6 STEAROYL DESATURASE DEFICIENCY 4, FATTY ACID DESATURASE C, fatty acid desaturase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012008 301 / 6e-107 AT3G12120 248 / 1e-82 fatty acid desaturase 2 (.1.2)
Lus10004175 280 / 3e-95 AT3G12120 635 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021051 280 / 5e-95 AT3G12120 634 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021045 218 / 1e-70 AT3G12120 500 / 2e-178 fatty acid desaturase 2 (.1.2)
Lus10004176 217 / 2e-70 AT3G12120 519 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021050 215 / 1e-69 AT3G12120 521 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004178 213 / 7e-69 AT3G12120 532 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004177 212 / 2e-68 AT3G12120 508 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021047 211 / 3e-68 AT3G12120 502 / 9e-179 fatty acid desaturase 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G192000 253 / 2e-84 AT3G12120 629 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.016G046200 248 / 2e-82 AT3G12120 624 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012500 217 / 4e-71 AT3G12120 480 / 3e-171 fatty acid desaturase 2 (.1.2)
Potri.001G012700 213 / 9e-69 AT3G12120 553 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012401 213 / 4e-68 AT3G12120 571 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G252900 110 / 4e-29 AT2G29980 539 / 0.0 fatty acid desaturase 3 (.1.2)
Potri.016G117500 108 / 3e-28 AT5G05580 592 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.006G101500 107 / 5e-28 AT5G05580 632 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.010G187800 106 / 2e-27 AT5G05580 683 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.008G069600 102 / 5e-26 AT5G05580 689 / 0.0 fatty acid desaturase 8 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00487 FA_desaturase Fatty acid desaturase
PF11960 DUF3474 Domain of unknown function (DUF3474)
Representative CDS sequence
>Lus10029284 pacid=23139830 polypeptide=Lus10029284 locus=Lus10029284.g ID=Lus10029284.BGIv1.0 annot-version=v1.0
ATGGGTGCCGGTGGCAGAATGTCAGTGCCTCCATCATCCAAACCTATGAAGAGGTCTCCTTACTCAAAGCCACCATTCACGCTCGGTGAGCTCAAGAAGG
CCATTCCTCCACACTGTTTCAAACGTTCAATCCCCCGATCGTTCGCCTACGTGGCGTACGACCTCACCATTGCAGCAATCTTCTACTACATCGCCACCAC
TTACTTCCACCTCCTCCCTAGCCCTCTCAACTACCTCGCCTGGCCGGTCTACTGGGCCTGCCAGGGCTGCATCCTCACTGGAGTATGGGTGTTGGCTCAC
GAATGCGGTCACCATGCCTTCAGCGACTACCAGTGGCTCGACGACATGGTTGGCTTCGTCCTCCATTCGTCCCTCCTTGTTCCTTACTTCTCCTGGAAGC
ACAGCCACCGCCGCCACCATTCAAACACGGGGTCGCTTCAGCCACCGCCGCCACCATTCCAACACGGGATCGCTTGA
AA sequence
>Lus10029284 pacid=23139830 polypeptide=Lus10029284 locus=Lus10029284.g ID=Lus10029284.BGIv1.0 annot-version=v1.0
MGAGGRMSVPPSSKPMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAYDLTIAAIFYYIATTYFHLLPSPLNYLAWPVYWACQGCILTGVWVLAH
ECGHHAFSDYQWLDDMVGFVLHSSLLVPYFSWKHSHRRHHSNTGSLQPPPPPFQHGIA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10029284 0 1
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10012008 1.0 0.8965
AT4G24280 CPHSC70-1 chloroplast heat shock protein... Lus10027341 4.7 0.8541
AT1G08470 SSL3 strictosidine synthase-like 3 ... Lus10013370 6.5 0.8134
AT4G23490 Protein of unknown function (D... Lus10028769 9.6 0.8314
AT4G30950 FADC, SFD4, FAD... STEAROYL DESATURASE DEFICIENCY... Lus10035831 12.4 0.7927
AT1G71920 HISN6B HISTIDINE BIOSYNTHESIS 6B (.1.... Lus10013699 13.4 0.8193
AT2G31170 FIONA, SYCOARAT... cysteinyl t-RNA synthetase, FI... Lus10001921 14.7 0.8197
AT2G28000 Cpn60alpha1, SL... SCHLEPPERLESS, chaperonin-60al... Lus10041329 16.9 0.8126
AT3G59760 ATCS-C, OASC ARABIDOPSIS THALIANA CYSTEINSY... Lus10027056 18.5 0.8106
AT2G04030 Hsp88.1, AtHsp9... HEAT SHOCK PROTEIN 88.1, EMBRY... Lus10036843 18.6 0.7925

Lus10029284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.