Lus10029285 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10330 71 / 2e-16 Cyclin-like family protein (.1)
AT2G41630 64 / 5e-14 TFIIB transcription factor IIB (.1)
AT5G39230 49 / 4e-09 TFIIB zinc-binding protein (.1)
AT3G29380 50 / 7e-09 pBRP2 plant-specific TFIIB-related protein 2, Cyclin-like family protein (.1)
AT4G10680 37 / 0.0002 transcription factor IIB (TFIIB) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016260 80 / 1e-19 AT3G10330 499 / 5e-180 Cyclin-like family protein (.1)
Lus10035440 74 / 3e-17 AT3G10330 603 / 0.0 Cyclin-like family protein (.1)
Lus10031056 60 / 8e-14 AT3G10330 109 / 7e-31 Cyclin-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G057100 71 / 2e-16 AT3G10330 611 / 0.0 Cyclin-like family protein (.1)
Potri.006G048400 68 / 2e-15 AT3G10330 605 / 0.0 Cyclin-like family protein (.1)
Potri.015G067500 62 / 5e-13 AT3G10330 499 / 5e-180 Cyclin-like family protein (.1)
Potri.017G093100 48 / 4e-08 AT3G10330 333 / 1e-114 Cyclin-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Representative CDS sequence
>Lus10029285 pacid=23139897 polypeptide=Lus10029285 locus=Lus10029285.g ID=Lus10029285.BGIv1.0 annot-version=v1.0
ATGTTGGACGAGACGTCTGAGTACAACTGCTCGGACTGCAAGCGGCAAACGGAGGTGGTGCACGACCAGTCGGCGGGGGATACGATCTGCAGCGAATGCA
GCCTTGTCCTCGACTCTCACTACATGGACAATCCCGTCAGAGTCGGAGGTCCCACCACACCTCGATCAGCAAGGCTGACGGACTTTTTAGTGCATACGAT
CGATTAA
AA sequence
>Lus10029285 pacid=23139897 polypeptide=Lus10029285 locus=Lus10029285.g ID=Lus10029285.BGIv1.0 annot-version=v1.0
MLDETSEYNCSDCKRQTEVVHDQSAGDTICSECSLVLDSHYMDNPVRVGGPTTPRSARLTDFLVHTID

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10330 Cyclin-like family protein (.1... Lus10029285 0 1

Lus10029285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.