Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06740 93 / 7e-24 Concanavalin A-like lectin protein kinase family protein (.1) AT3G53380 57 / 4e-11 Concanavalin A-like lectin protein kinase family protein (.1) AT5G03140 57 / 5e-11 Concanavalin A-like lectin protein kinase family protein (.1) AT5G55830 51 / 6e-09 Concanavalin A-like lectin protein kinase family protein (.1) AT3G53810 50 / 2e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT5G65600 49 / 3e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT4G04960 49 / 5e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT5G10530 46 / 3e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT1G15530 46 / 3e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT1G66910 45 / 6e-07 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016257 [exp] 155 / 9e-46 AT5G06740 638 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10021060 [exp] 88 / 6e-22 AT5G06740 667 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10004166 [exp] 87 / 1e-21 AT5G06740 682 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10019923 [exp] 64 / 1e-13 AT3G53380 927 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10019879 [exp] 56 / 2e-10 AT1G15530 621 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10004279 [exp] 54 / 4e-10 AT5G10530 578 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020452 [exp] 54 / 5e-10 AT5G10530 510 / 2e-173 Concanavalin A-like lectin protein kinase family protein (.1) Lus10014037 [exp] 54 / 6e-10 AT1G15530 807 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10028699 [exp] 52 / 2e-09 AT5G06740 455 / 1e-151 Concanavalin A-like lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G193000 [exp] 86 / 2e-21 AT5G06740 688 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.016G045000 [exp] 81 / 2e-19 AT5G06740 702 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.006G130000 [exp] 61 / 3e-12 AT3G53380 866 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.015G083300 [exp] 59 / 9e-12 AT1G15530 759 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.016G087800 [exp] 59 / 9e-12 AT3G53380 881 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.012G084900 [exp] 56 / 1e-10 AT1G15530 734 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G368300 [exp] 55 / 3e-10 AT5G55830 853 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G455500 [exp] 55 / 3e-10 AT5G06740 416 / 1e-136 Concanavalin A-like lectin protein kinase family protein (.1) Potri.011G093700 [exp] 51 / 7e-09 AT5G55830 849 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G036500 [exp] 49 / 3e-08 AT5G60280 617 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029291 pacid=23139938 polypeptide=Lus10029291 locus=Lus10029291.g ID=Lus10029291.BGIv1.0 annot-version=v1.0 ATGAAGAGGGGTTTCGAGGACGAAAAATTGCAGAATGTTCTTACTTTGGGGTTGGCTTGTTGCCATCCTGACCCGTACGGAAGGCCTTCCATGAAAACTG TTGTTCAGGTTCTGACAGGAGAAGTTGCAGCCGTACCTGAAGTTCCCCTGGAAAGGCCTGCCTTCACTTGGCCGCCTGTCGCTCGGTGTTTTGAAGATCG TCGATCCATGACGGATAGCCAATCGTTTACAGAGATTACTGGGGGATGA
AA sequence Show only first row Show all	>Lus10029291 pacid=23139938 polypeptide=Lus10029291 locus=Lus10029291.g ID=Lus10029291.BGIv1.0 annot-version=v1.0 MKRGFEDEKLQNVLTLGLACCHPDPYGRPSMKTVVQVLTGEVAAVPEVPLERPAFTWPPVARCFEDRRSMTDSQSFTEITGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06740			Concanavalin A-like lectin pro...		Lus10029291 [exp]	0	1
AT4G38080			hydroxyproline-rich glycoprote...		Lus10029845 [exp]	3.0	0.7059
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036538 [exp]	3.5	0.6662
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10038179 [exp]	13.9	0.6590
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017676 [exp]	20.0	0.6404
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10036079 [exp]	29.5	0.6495
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	36.1	0.6220
AT4G14746			unknown protein		Lus10025761 [exp]	42.8	0.5774
AT3G07870			F-box and associated interacti...		Lus10012356 [exp]	44.8	0.5858
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10005190 [exp]	54.4	0.5945
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10016918 [exp]	57.3	0.6259

Compare expression of checked genes

Lus10029291 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.