Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58060 62 / 1e-12 Cation efflux family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029304 [exp] 107 / 4e-29 AT3G58060 577 / 0.0 Cation efflux family protein (.1) Lus10016239 [exp] 105 / 4e-28 AT3G58060 574 / 0.0 Cation efflux family protein (.1) Lus10016244 [exp] 50 / 2e-08 AT3G58050 851 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G010300 [exp] 64 / 2e-13 AT3G58060 479 / 4e-169 Cation efflux family protein (.1) Potri.001G010000 [exp] 63 / 6e-13 AT3G58060 529 / 0.0 Cation efflux family protein (.1) Potri.001G010200 [exp] 63 / 6e-13 AT3G58060 540 / 0.0 Cation efflux family protein (.1) Potri.003G215600 [exp] 51 / 9e-09 AT3G58060 521 / 0.0 Cation efflux family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029300 pacid=23139971 polypeptide=Lus10029300 locus=Lus10029300.g ID=Lus10029300.BGIv1.0 annot-version=v1.0 ATGCTGAAGCTGAAGGACCAGTCTGGTCACTCTGTAATGAAGGGAGATTTCGTGTCAAACTTGCCCCGTTCAGGGATCGGTCCTCCTTTCGAAGTTGATC TCTCCAAAGCAACTGGCCTGATTGGAGGTGAGAAGGAATACTACGAGAGACAATTCGCTATACTGAAGTCTTTCGAGGATGTTGATTCGCTCGAGGAACC AAAGGCCGAAGAGCAGGATATGCATGAGCTCGCTCGTGCATATTTCCAACTGGGCAAATATCTTTCTCCTCTCCCTGAGCATCAATGGGGGTGTTGA
AA sequence Show only first row Show all	>Lus10029300 pacid=23139971 polypeptide=Lus10029300 locus=Lus10029300.g ID=Lus10029300.BGIv1.0 annot-version=v1.0 MLKLKDQSGHSVMKGDFVSNLPRSGIGPPFEVDLSKATGLIGGEKEYYERQFAILKSFEDVDSLEEPKAEEQDMHELARAYFQLGKYLSPLPEHQWGC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58060			Cation efflux family protein (...		Lus10029300 [exp]	0	1
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10013118 [exp]	5.7	0.8306
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003452 [exp]	13.8	0.7214
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007853 [exp]	15.2	0.7481
AT1G05200		GLUR3, ATGLR3.4	glutamate receptor 3.4 (.1.2)		Lus10005276 [exp]	15.7	0.7800
AT4G00910			Aluminium activated malate tra...		Lus10001528 [exp]	18.8	0.8027
AT1G03890			RmlC-like cupins superfamily p...		Lus10033893 [exp]	19.7	0.7346
AT1G79800		AtENODL7	early nodulin-like protein 7 (...		Lus10011433 [exp]	20.1	0.7010
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	20.5	0.7442
					Lus10038978 [exp]	24.0	0.7546
AT3G02920		ATRPA32B	Replication protein A, subunit...		Lus10015505 [exp]	30.2	0.6698

Compare expression of checked genes

Lus10029300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.