Lus10029302 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
AT1G09590 294 / 1e-103 Translation protein SH3-like family protein (.1)
AT1G57860 289 / 8e-102 Translation protein SH3-like family protein (.1)
AT1G57660 289 / 8e-102 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016241 333 / 3e-119 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030607 320 / 4e-114 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 320 / 9e-114 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10021079 300 / 4e-106 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 300 / 4e-106 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 303 / 3e-107 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 302 / 7e-107 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 296 / 2e-104 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 291 / 2e-102 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Lus10029302 pacid=23139786 polypeptide=Lus10029302 locus=Lus10029302.g ID=Lus10029302.BGIv1.0 annot-version=v1.0
ATGCCTGCCGGTCACGGTCTCCGCTCCCGTACTAGGGATCTCTTCTCCCGGCCATTCAGGAAGCGGGGTTACATCCCTCTGACCACCTACCTCCGTACCT
ACAAGGTCGGCGACTACGTCGACGTCAAGGTCAATGGCGCCATCCACAAAGGTATGCCTCACAAGTTCTACCATGGACGCACCGGCCGCGTCTGGAACGT
TACCAAGCGCGCCATCGGCGTCGAGATGAACAAGCAGGTGAGGGGCAAGATCTTGAAGAAAAGGATCCACGTCAGGATCGAGCACGTAATTCCATCAAGG
TGCACTGAGGACTTGCAGATCAGGAAGAAGAAGAACGACGAGCTTAAGGCAGCAGCCAAGGCCAGAGGCGAAGTCATCAGCACCAAGAGGCAGCCCCTTG
GCCCGAAACCCGGTTTCATGGTGGAGGGTGCTACGCTCGAAACCGTCACTCCCATCCCCTATGATGTCACCAATGACCTTAAGGGCGGGTACTAG
AA sequence
>Lus10029302 pacid=23139786 polypeptide=Lus10029302 locus=Lus10029302.g ID=Lus10029302.BGIv1.0 annot-version=v1.0
MPAGHGLRSRTRDLFSRPFRKRGYIPLTTYLRTYKVGDYVDVKVNGAIHKGMPHKFYHGRTGRVWNVTKRAIGVEMNKQVRGKILKKRIHVRIEHVIPSR
CTEDLQIRKKKNDELKAAAKARGEVISTKRQPLGPKPGFMVEGATLETVTPIPYDVTNDLKGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09690 Translation protein SH3-like f... Lus10029302 0 1
AT2G40510 Ribosomal protein S26e family ... Lus10034223 3.2 0.9607
AT2G38730 Cyclophilin-like peptidyl-prol... Lus10026161 3.3 0.9421
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023457 3.9 0.9565
AT1G09760 U2A' U2 small nuclear ribonucleopro... Lus10028659 4.5 0.9422
AT4G12540 unknown protein Lus10025820 5.9 0.9268
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 6.6 0.9571
AT4G39200 Ribosomal protein S25 family p... Lus10021706 7.3 0.9454
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 7.4 0.9500
AT1G09590 Translation protein SH3-like f... Lus10017232 7.5 0.9528
AT4G01560 MEE49 maternal effect embryo arrest ... Lus10030171 11.2 0.9400

Lus10029302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.