Lus10029306 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65870 207 / 2e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 196 / 5e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 188 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 185 / 8e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 182 / 9e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT5G42500 179 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 177 / 2e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 175 / 5e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 174 / 1e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 162 / 5e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017231 223 / 1e-74 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 211 / 7e-70 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 208 / 1e-68 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016237 203 / 9e-68 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 184 / 4e-59 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 181 / 4e-58 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 180 / 1e-57 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 176 / 6e-56 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 172 / 1e-54 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G061000 263 / 2e-90 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 256 / 1e-87 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 245 / 2e-83 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 233 / 1e-78 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 223 / 1e-74 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 221 / 6e-74 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 211 / 6e-70 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 208 / 7e-69 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.009G131000 201 / 4e-66 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 188 / 2e-61 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10029306 pacid=23139948 polypeptide=Lus10029306 locus=Lus10029306.g ID=Lus10029306.BGIv1.0 annot-version=v1.0
ATGGCCAAATACTCTGTCTTCCTCCTCCTCCTCCTCCTCCTCCTCACCTCAGCCCTCTCCTCCGCCATCTCCGCTGCAACTGCAAAACCCCGCGGCGGCT
TCTCCCGCATGCTCTCGCCGGCGACCTTCCGCCTGAAGAAGGAGAAGCTGAGCCACCTCCACTTCTACTTCCACGACATCGTCAGCGGGCCTAACCCAAC
CGCAGTCCAGATAGCCCAGGCTCACTCCACCAACCTATCCGCCACGGGCTTCGGAATGACGGCCATGATCGACGACCCGCTGACCGCTGGGCCGGAGCGC
ACTTCCAAGCTGGTGGGCCGGGCCCAGGGGATCTACGGCTCCGCCTCGCAGTCGGAAGTGGGCCTGCTGATGGCGCTTAATTTTGCGTTTGTGGAAGGGA
AGTATAACGGGAGCACGCTGAGCGTGCTGGGGAGGAACGCCGTGATGTCGCCGGTGAGGGAGATACCGGTGATCGGCGGGAGTGGGGTTTTCCGGTTTGC
TAGAGGGTATGCTAAGGCGAAGACTAGGGTTTATGATGTCAAGACCGGGGATGCTGTTGTTGAGTATAATGTCTACGTTTTCCATTATTGA
AA sequence
>Lus10029306 pacid=23139948 polypeptide=Lus10029306 locus=Lus10029306.g ID=Lus10029306.BGIv1.0 annot-version=v1.0
MAKYSVFLLLLLLLLTSALSSAISAATAKPRGGFSRMLSPATFRLKKEKLSHLHFYFHDIVSGPNPTAVQIAQAHSTNLSATGFGMTAMIDDPLTAGPER
TSKLVGRAQGIYGSASQSEVGLLMALNFAFVEGKYNGSTLSVLGRNAVMSPVREIPVIGGSGVFRFARGYAKAKTRVYDVKTGDAVVEYNVYVFHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65870 Disease resistance-responsive ... Lus10029306 0 1
AT3G51990 Protein kinase superfamily pro... Lus10015478 6.0 0.8259
AT5G23100 Protein of unknown function, D... Lus10038951 8.9 0.8240
AT1G61500 S-locus lectin protein kinase ... Lus10024081 11.8 0.8413
AT4G37980 ELI3-1, ATCAD7 CINNAMYL-ALCOHOL DEHYDROGENASE... Lus10023268 15.7 0.8685
Lus10042813 18.3 0.8581
AT2G36780 UDP-Glycosyltransferase superf... Lus10012011 22.7 0.8606
AT1G14185 Glucose-methanol-choline (GMC)... Lus10032347 26.8 0.8588
AT1G23850 unknown protein Lus10014532 28.0 0.7850
AT3G22560 Acyl-CoA N-acyltransferases (N... Lus10039343 35.8 0.7648
AT1G19630 CYP722A1 "cytochrome P450, family 722, ... Lus10014285 38.3 0.8394

Lus10029306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.