Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11930 179 / 4e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 160 / 1e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G09740 98 / 8e-26 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 81 / 2e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 81 / 3e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 79 / 3e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 77 / 9e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 76 / 3e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G53990 62 / 3e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 62 / 3e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009272 [exp] 103 / 7e-28 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016233 [exp] 92 / 2e-24 AT3G11930 79 / 7e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10041436 [exp] 89 / 2e-22 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 90 / 7e-22 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 87 / 1e-21 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 86 / 2e-21 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 85 / 9e-21 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 90 / 1e-20 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10032142 [exp] 78 / 5e-18 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G064000 [exp] 211 / 6e-70 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 206 / 7e-68 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 102 / 1e-27 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 95 / 1e-24 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 91 / 3e-23 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 91 / 4e-23 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 87 / 1e-21 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 87 / 1e-21 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 86 / 4e-21 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G130100 [exp] 85 / 6e-21 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10029310 pacid=23139829 polypeptide=Lus10029310 locus=Lus10029310.g ID=Lus10029310.BGIv1.0 annot-version=v1.0 ATGTCGGGGCATCAGCAGAGGAGGGTGACGCCGTTGAAAGTGATGGTGGCGATCGACGAGAGCGACGGAAGCTTCTATGCCCTCCAGTGGGTCCTGGACC ACCTTGTCGGAGGCGGAGGAGGAGGCATTGTCCCGTCGAACGAGCCGGGCTTGGAGGATACAGGAATGGTGACGCTGGTTCATGTTCAGCAGGGTTTCCA CCCGCAGGTCTTGCCCGTTGGCCCCGGCGACGGAGGTGCTGCAGCGTTTTACGCAACATCGACGACCTTTCAACAATCCATGAAAGCAGCCGCGGCAGAG AATTCGGCGGCGCTATTGGCCCGAGCCATGAAACTGTGCAGTGACAAGATGATAAAGGCGGAAACTCTGGTGCTAGAGGGAGATGCAAAGGACAAGCTGT GCCAAGCGACAGAGCAGAGCCACGTGGATCTCCTCGTGGTTGGAAGCCGCGGCTTAAGCAAAATCAAAAGAGCGTTTCTGGGGAGCGTGAGCGATTTCTG CGCACACCATGCGAAGTGTCCGGTCCTCATCGTCAAGCCTAACCCTGCGGACAATCATACCAGCAGCAGCACCACCACCACCGGAGGAGCTCGCCATTAA
AA sequence Show only first row Show all	>Lus10029310 pacid=23139829 polypeptide=Lus10029310 locus=Lus10029310.g ID=Lus10029310.BGIv1.0 annot-version=v1.0 MSGHQQRRVTPLKVMVAIDESDGSFYALQWVLDHLVGGGGGGIVPSNEPGLEDTGMVTLVHVQQGFHPQVLPVGPGDGGAAAFYATSTTFQQSMKAAAAE NSAALLARAMKLCSDKMIKAETLVLEGDAKDKLCQATEQSHVDLLVVGSRGLSKIKRAFLGSVSDFCAHHAKCPVLIVKPNPADNHTSSSTTTTGGARH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11930			Adenine nucleotide alpha hydro...		Lus10029310 [exp]	0	1
					Lus10026149 [exp]	1.0	0.9999
AT3G15990		SULTR3;4	sulfate transporter 3;4 (.1)		Lus10043247 [exp]	2.0	0.9995
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Lus10039186 [exp]	10.6	0.9891
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10034971 [exp]	11.0	0.9879
AT5G41460			Protein of unknown function (D...		Lus10018123 [exp]	17.7	0.9698
AT4G35160			O-methyltransferase family pro...		Lus10017691 [exp]	17.9	0.9966
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10007220 [exp]	22.4	0.9933
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008921 [exp]	23.0	0.9569
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Lus10007645 [exp]	23.2	0.9529
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Lus10028316 [exp]	24.8	0.9721

Compare expression of checked genes

Lus10029310 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.