Lus10029312 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13660 135 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 127 / 9e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 125 / 5e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 124 / 2e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT3G13650 122 / 1e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 122 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 115 / 4e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 112 / 1e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 110 / 5e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 112 / 1e-30 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016231 241 / 3e-82 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10000376 193 / 2e-64 AT5G42510 87 / 1e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10018340 167 / 2e-53 AT1G58170 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 135 / 1e-40 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 135 / 2e-40 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 132 / 2e-39 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 122 / 3e-35 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016237 118 / 1e-34 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 117 / 1e-32 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G061000 141 / 6e-43 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 138 / 1e-41 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 138 / 1e-41 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216300 138 / 1e-41 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 134 / 3e-40 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 130 / 8e-39 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 127 / 1e-37 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 126 / 2e-37 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 123 / 5e-36 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 119 / 3e-34 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10029312 pacid=23139959 polypeptide=Lus10029312 locus=Lus10029312.g ID=Lus10029312.BGIv1.0 annot-version=v1.0
ATGTGTTTCGATACTCATACAATACTCAAATTTCGATTCAAATTCAACTCAGTGTATGTTTTGATACTGGATCTGTCATCGACCAACACCACCTCCCCCA
ATGTCACCGACGTCCTCTCCATCCGCCCTGCCTTGCCCAACTCCCCTGTTGGCTTCGGGGCCATAAGCGTCTTCGACCACCCCCTCACCGCTGGGCCCAT
CCCTGGCTCGTCCTTGCTGGGCAGAGCTCAGGGCTCCTACGCGTCTGCTTCTCAGCATACGTTCGGGATTATGATGGCGATGAACTTGGTGTTTGTGGGC
AGTAAGTTCAACGGAAGCAGCCTCACCGTGATGGGAAGGAATGAAGTGCCGTTGAAGGTTAGAGAGTTGCCGGTGGTCGGCGGGACAGGAGTTTTCCGGC
TGGCTAGGGGCTATGTTCTTATGAATACGTACTTCTTTGACCCTACAGCTGGGCTTGCCTTCGTTGAGTATAATATCTACGCTTTGCATTATTGGTAA
AA sequence
>Lus10029312 pacid=23139959 polypeptide=Lus10029312 locus=Lus10029312.g ID=Lus10029312.BGIv1.0 annot-version=v1.0
MCFDTHTILKFRFKFNSVYVLILDLSSTNTTSPNVTDVLSIRPALPNSPVGFGAISVFDHPLTAGPIPGSSLLGRAQGSYASASQHTFGIMMAMNLVFVG
SKFNGSSLTVMGRNEVPLKVRELPVVGGTGVFRLARGYVLMNTYFFDPTAGLAFVEYNIYALHYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13660 Disease resistance-responsive ... Lus10029312 0 1
AT3G27700 C3HZnF zinc finger (CCCH-type) family... Lus10032140 29.2 0.7404
AT3G13300 VCS VARICOSE, Transducin/WD40 repe... Lus10038767 56.0 0.7205
AT5G56700 FBD / Leucine Rich Repeat doma... Lus10017238 56.1 0.7104
AT1G66430 pfkB-like carbohydrate kinase ... Lus10002101 79.1 0.6593
AT5G43900 XI-6, XI-2, ATM... MYOSIN XI-6, MYOSIN X1 2, ARAB... Lus10032597 111.7 0.6561
AT1G08060 MOM1, MOM MORPHEUS MOLECULE 1, MORPHEUS ... Lus10037390 112.2 0.6951

Lus10029312 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.