Lus10029313 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT4G21705 125 / 1e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02150 114 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G01990 108 / 8e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02370 107 / 4e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G09450 100 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02820 100 / 1e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G60770 99 / 1e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G28020 97 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G15480 88 / 1e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000247 367 / 2e-128 AT2G20710 92 / 3e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10016229 333 / 5e-112 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005600 257 / 9e-86 AT2G20710 91 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005599 130 / 7e-37 AT2G20710 88 / 8e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10018588 127 / 2e-32 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005855 122 / 3e-30 AT4G21705 503 / 5e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021053 120 / 6e-30 AT1G02370 494 / 3e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001213 120 / 1e-29 AT4G21705 500 / 2e-174 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003590 117 / 7e-29 AT4G21705 434 / 2e-148 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G063400 163 / 3e-45 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G133000 160 / 1e-44 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.016G063300 155 / 2e-42 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G132700 154 / 5e-42 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.011G120900 149 / 2e-40 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G132500 144 / 1e-38 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.011G051700 130 / 2e-35 AT2G20710 151 / 1e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.014G050300 125 / 2e-31 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G139400 124 / 4e-31 AT1G02150 714 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G194400 123 / 7e-31 AT1G02370 466 / 2e-160 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10029313 pacid=23139783 polypeptide=Lus10029313 locus=Lus10029313.g ID=Lus10029313.BGIv1.0 annot-version=v1.0
ATGAGTCTCTCTCGATTCCTCCTCAGACTCGCTTCCACCGTCTCTCCGTTCTCCGCCGGCGGCCGTTTCGGTTCACACTTCCATTCAAATGTTCCTTACA
GCTCCGCCGCATCAGCGGCAGCTAGGCCCTCTTCGAACGGGAACTTCACCAGTCCAACCAACGAATCCAGAAATGAGCTTTACCGGCGAATTTCGCCGAT
CGGGGATCCCAAGGTCTCCATTGTTCCGATTCTCGATCGATGGATTGAAGAAGGAAAGTCCGTCGACAAGCACCAGCTCGTTTCATATATCAAAGAGCTC
CGCTACTTCGGTCGTCACTATCACGCCCTTGAGATCTCCAAGTGGATGACAGACAAAAGGTACTTGGAACTAACTTCACGAGATGCTGCAATAAGGCTGG
ACTTGATAGCTAAGGTTCAAGGGCTAAAACCAGCAGCCAACTACTTCGTAACTCTCCCTCAGCAGCTTAAAGGGGTCAATACTTACGGCTCACTTCTCAA
CTGCTACTGTCGCGTCCAGTCTGTGGAGAAGGCAGAGGCACTAAACAAAAAGAAAAAAGATATCAAAGCATACTATTACCTCCTCACAAGCTACGCAGCC
ATGGGGAAGAAAGATGAAGTCTTTGAAGTTTGGGAACGTCTCAAGAAGAGCGGGAAGAAGGTTCTCAACAAAGGGTACATGGACTTGATATCTTCCATCA
CGAAGCTGGGCGATTTCGAGGCTGCTGAGAAGATACTCGACAAGTGGGAGTCTCGGAAGAGCCCTGGTTACGATGTCCGCATCCCTCACGTCCTCGTCAG
CGCCTACATGAAAGTTGGCCGTTTGGAAGAAGCCGGGGCCGTCGTGGAGAGGATGAGATCGAAAGGCGTCCAGCCACACGCGAACTCGTGGCTTTCGTTG
GCGGTAGGGTATCTCGAGCATCGTAAGGATGTGTTGAAGGCGGTGGAGGCGATGAAGAGAGGCGTAACGGTGTCGGAGTCAGGTTGGAAACCCGACCCGA
GAGGGTTGGCCGAGTGTCTGCAGCAGTTGAAAGATGCTGGGGGAGATCGTTTGGAGGAAGCGCGAGAGCTTGTGCAATTGCTGATGGAGCAGAATGTTGT
TCCTTTAGCTGTTGGAAAGAAATGGTTGGTCGATGGTTCATCTGATCGGGTTGAAGAATCGGCTGAGTGA
AA sequence
>Lus10029313 pacid=23139783 polypeptide=Lus10029313 locus=Lus10029313.g ID=Lus10029313.BGIv1.0 annot-version=v1.0
MSLSRFLLRLASTVSPFSAGGRFGSHFHSNVPYSSAASAAARPSSNGNFTSPTNESRNELYRRISPIGDPKVSIVPILDRWIEEGKSVDKHQLVSYIKEL
RYFGRHYHALEISKWMTDKRYLELTSRDAAIRLDLIAKVQGLKPAANYFVTLPQQLKGVNTYGSLLNCYCRVQSVEKAEALNKKKKDIKAYYYLLTSYAA
MGKKDEVFEVWERLKKSGKKVLNKGYMDLISSITKLGDFEAAEKILDKWESRKSPGYDVRIPHVLVSAYMKVGRLEEAGAVVERMRSKGVQPHANSWLSL
AVGYLEHRKDVLKAVEAMKRGVTVSESGWKPDPRGLAECLQQLKDAGGDRLEEARELVQLLMEQNVVPLAVGKKWLVDGSSDRVEESAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10029313 0 1

Lus10029313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.