Lus10029316 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 60 / 1e-12 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 43 / 2e-06 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 42 / 5e-06 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT2G22200 37 / 0.0002 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G22190 37 / 0.0002 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1)
AT1G36060 37 / 0.0003 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G33710 36 / 0.0005 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT2G20880 36 / 0.0008 AP2_ERF AtERF53 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016210 76 / 6e-19 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016225 74 / 5e-18 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016209 73 / 9e-18 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10029334 73 / 9e-18 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Lus10016211 73 / 2e-17 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10029333 71 / 8e-17 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016224 70 / 2e-16 AT2G44840 143 / 1e-42 ethylene-responsive element binding factor 13 (.1)
Lus10016212 68 / 2e-15 AT2G44840 146 / 1e-43 ethylene-responsive element binding factor 13 (.1)
Lus10029331 66 / 6e-15 AT2G44840 147 / 4e-44 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 68 / 1e-15 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 59 / 3e-12 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 58 / 7e-12 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 51 / 6e-10 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.001G079900 52 / 1e-09 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.003G150700 51 / 3e-09 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.014G046900 51 / 3e-09 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.003G081200 45 / 3e-07 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 44 / 7e-07 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.019G102200 39 / 9e-05 AT2G20880 195 / 2e-58 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10029316 pacid=23139892 polypeptide=Lus10029316 locus=Lus10029316.g ID=Lus10029316.BGIv1.0 annot-version=v1.0
ATGTTGAGAAGAGTGGCTTGGGGATATTTCGCTGCAGCTTTGGCTTACGACAGAGATGCTTTCCAAATGAGGGAAGCCAAAGCTAAATTCAATTTCCCGC
ATCTAGTGGGGTCTACTGATTACGAGCCTGTTAGAGTTATTAACAAAAAAGAGTGGTTCCCCGAAGCCATCGTCCTCCGGGGACTCGTTGTCGGGATCGG
AAAGTGA
AA sequence
>Lus10029316 pacid=23139892 polypeptide=Lus10029316 locus=Lus10029316.g ID=Lus10029316.BGIv1.0 annot-version=v1.0
MLRRVAWGYFAAALAYDRDAFQMREAKAKFNFPHLVGSTDYEPVRVINKKEWFPEAIVLRGLVVGIGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029316 0 1
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10006917 1.0 0.9982
AT2G29490 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, ... Lus10007896 5.6 0.9190
AT1G25270 nodulin MtN21 /EamA-like trans... Lus10015066 6.2 0.9736
Lus10043052 6.6 0.8806
Lus10007508 7.7 0.9695
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10034502 8.1 0.9132
AT1G04670 unknown protein Lus10004041 8.9 0.9695
AT5G60010 ferric reductase-like transmem... Lus10019390 10.0 0.9695
AT3G53690 RING/U-box superfamily protein... Lus10042610 11.0 0.9695
Lus10006918 11.8 0.9695

Lus10029316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.