Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58480 84 / 6e-20 calmodulin-binding family protein (.1) AT3G13600 76 / 4e-17 calmodulin-binding family protein (.1) AT2G26190 64 / 6e-13 calmodulin-binding family protein (.1) AT3G52870 62 / 3e-12 IQ calmodulin-binding motif family protein (.1) AT4G33050 59 / 2e-11 EDA39 embryo sac development arrest 39, calmodulin-binding family protein (.1.2.3.4) AT5G57010 59 / 3e-11 calmodulin-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016219 [exp] 192 / 7e-60 AT3G58480 569 / 0.0 calmodulin-binding family protein (.1) Lus10039178 [exp] 79 / 4e-18 AT3G13600 697 / 0.0 calmodulin-binding family protein (.1) Lus10025173 [exp] 78 / 5e-18 AT3G13600 575 / 0.0 calmodulin-binding family protein (.1) Lus10016052 [exp] 78 / 6e-18 AT3G13600 582 / 0.0 calmodulin-binding family protein (.1) Lus10013759 [exp] 77 / 1e-17 AT3G58480 690 / 0.0 calmodulin-binding family protein (.1) Lus10003257 [exp] 67 / 5e-14 AT3G52870 576 / 0.0 IQ calmodulin-binding motif family protein (.1) Lus10035595 [exp] 67 / 6e-14 AT3G52870 575 / 0.0 IQ calmodulin-binding motif family protein (.1) Lus10013526 [exp] 64 / 8e-13 AT5G57010 581 / 0.0 calmodulin-binding family protein (.1) Lus10014872 [exp] 60 / 1e-11 AT4G33050 577 / 0.0 embryo sac development arrest 39, calmodulin-binding family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G197500 [exp] 91 / 2e-22 AT3G58480 588 / 0.0 calmodulin-binding family protein (.1) Potri.016G063000 [exp] 83 / 1e-19 AT3G58480 587 / 0.0 calmodulin-binding family protein (.1) Potri.003G218800 [exp] 79 / 4e-18 AT3G13600 734 / 0.0 calmodulin-binding family protein (.1) Potri.001G006200 [exp] 74 / 1e-16 AT3G13600 697 / 0.0 calmodulin-binding family protein (.1) Potri.006G114700 [exp] 66 / 8e-14 AT3G52870 561 / 0.0 IQ calmodulin-binding motif family protein (.1) Potri.006G226500 [exp] 64 / 3e-13 AT4G33050 433 / 9e-151 embryo sac development arrest 39, calmodulin-binding family protein (.1.2.3.4) Potri.006G226400 [exp] 64 / 4e-13 AT4G33050 598 / 0.0 embryo sac development arrest 39, calmodulin-binding family protein (.1.2.3.4) Potri.018G061901 [exp] 61 / 6e-12 AT4G33050 601 / 0.0 embryo sac development arrest 39, calmodulin-binding family protein (.1.2.3.4) Potri.006G147900 [exp] 57 / 1e-10 AT2G26190 513 / 2e-178 calmodulin-binding family protein (.1) Potri.008G023866 [exp] 56 / 2e-10 AT3G52870 293 / 1e-96 IQ calmodulin-binding motif family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029323 pacid=23139774 polypeptide=Lus10029323 locus=Lus10029323.g ID=Lus10029323.BGIv1.0 annot-version=v1.0 ATGGACACGTATCAGCTGGCGAATCAGCTTTCCTCCAAGTGGACGACGGGGGCTGGGCCGAGGATCGGGTGCATGAGGGATTATCCGATTGAGATTCAAT TTAGGGTGTTGGAGCATGCTCAATTGTCGCCGAGAGCGAGGAAGAGGCGTTATCCACTTAGGCCCTTGGCGCCGAGGTTTAGTGGTAATGGAGATGGAGG AGGAGGAGTTGTGCAGACGCCGACTGCGGCGTCGGCTGTGTCGCGGCCGATTTTGCATCGGAGAGCGGAGACTGCTGTGCCGGCGAAAATTCCGGTTGGG TTGGATCAAATTGAGATGTCAGCAGACTGA
AA sequence Show only first row Show all	>Lus10029323 pacid=23139774 polypeptide=Lus10029323 locus=Lus10029323.g ID=Lus10029323.BGIv1.0 annot-version=v1.0 MDTYQLANQLSSKWTTGAGPRIGCMRDYPIEIQFRVLEHAQLSPRARKRRYPLRPLAPRFSGNGDGGGGVVQTPTAASAVSRPILHRRAETAVPAKIPVG LDQIEMSAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58480			calmodulin-binding family prot...		Lus10029323 [exp]	0	1
AT1G66930			Protein kinase superfamily pro...		Lus10022367 [exp]	4.4	0.8159
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	7.7	0.8050
AT5G24600			Protein of unknown function, D...		Lus10015590 [exp]	8.7	0.7739
AT2G21950		SKIP6	SKP1 interacting partner 6 (.1...		Lus10030606 [exp]	11.7	0.7666
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10005044 [exp]	12.2	0.7136
					Lus10022880 [exp]	14.1	0.7724
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10011976 [exp]	14.5	0.7507
AT5G62140			unknown protein		Lus10038887 [exp]	16.5	0.7801
AT3G23920		BAM1, BMY7, TR-...	BETA-AMYLASE 7, beta-amylase 1...		Lus10023700 [exp]	21.0	0.6742
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	23.2	0.7657

Compare expression of checked genes

Lus10029323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.