Lus10029326 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03220 258 / 2e-89 Mediator complex, subunit Med7 (.1)
AT5G03500 254 / 8e-88 Mediator complex, subunit Med7 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016217 304 / 2e-107 AT5G03500 269 / 7e-94 Mediator complex, subunit Med7 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G062800 278 / 2e-97 AT5G03220 249 / 5e-86 Mediator complex, subunit Med7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05983 Med7 MED7 protein
Representative CDS sequence
>Lus10029326 pacid=23139980 polypeptide=Lus10029326 locus=Lus10029326.g ID=Lus10029326.BGIv1.0 annot-version=v1.0
ATGGCGACAGCTACATATCCACCTCCTCCGCCGTATTACAGACTGTATAAAGATTACTTGCAGAATCCCAAATCCGCCCCCCCGCCTCCTCCTCCAGTTG
AAGGAACGTACGTCTGCTATGGGGCAAACTACACTACTGATGATGTTCTTCCGAGCTTGGAAGATCAGGGAGTGCGTCAGCTGTACCCTAAGGGACCTAA
TGTTGATTTCAAGAAGGAATTAAGATCATTGAATAGAGAATTGCAGCTGCACATTTTGGAGCTTGCTGATGTTCTTGTCGAGAGACCGTCACAGTACGCT
CGGAGAGTGGAAGACATATCCCTTATTTTTAAGAATTTGCACCACCTTCTCAATTCGTTACGGCCCCATCAGGCAAGAGCCACGTTGATTCACATTCTGG
AGCTTCAGATTGAACGACGCAAACAAGCTGTGGAGGATATTAAGAGGAGGAGAGAAGAAGCACAGAAGCTTCTCAGGGAGGCTGTTGAAACGTTAGATGG
ACAGTAG
AA sequence
>Lus10029326 pacid=23139980 polypeptide=Lus10029326 locus=Lus10029326.g ID=Lus10029326.BGIv1.0 annot-version=v1.0
MATATYPPPPPYYRLYKDYLQNPKSAPPPPPPVEGTYVCYGANYTTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYA
RRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIERRKQAVEDIKRRREEAQKLLREAVETLDGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03500 Mediator complex, subunit Med7... Lus10029326 0 1
AT2G30620 winged-helix DNA-binding trans... Lus10022001 3.9 0.8372
AT3G24550 ATPERK1 proline-rich extensin-like rec... Lus10022129 7.6 0.8211
AT5G66240 Transducin/WD40 repeat-like su... Lus10017157 8.4 0.8103
AT4G24470 GATA GATA25, TIFY1, ... Zinc-finger protein expressed ... Lus10002412 10.7 0.8181
AT4G40045 unknown protein Lus10043427 11.9 0.7282
AT1G06060 LisH and RanBPM domains contai... Lus10004152 13.5 0.7172
AT5G14640 ATSK13 shaggy-like kinase 13 (.1) Lus10013088 17.8 0.8137
AT5G22120 unknown protein Lus10008366 23.8 0.7816
AT3G45890 RUS1 ROOT UVB SENSITIVE 1, Protein ... Lus10001413 24.3 0.6566
AT1G09815 POLD4 polymerase delta 4 (.1) Lus10020362 25.5 0.7710

Lus10029326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.