Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44840 50 / 7e-09 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016211 [exp] 120 / 7e-36 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1) Lus10016225 [exp] 98 / 7e-27 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1) Lus10016209 [exp] 84 / 1e-21 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1) Lus10029333 [exp] 79 / 1e-19 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1) Lus10016210 [exp] 77 / 6e-19 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1) Lus10029334 [exp] 71 / 9e-17 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1) Lus10029314 [exp] 61 / 1e-12 AT2G44840 139 / 6e-41 ethylene-responsive element binding factor 13 (.1) Lus10016224 [exp] 58 / 1e-11 AT2G44840 143 / 1e-42 ethylene-responsive element binding factor 13 (.1) Lus10029316 [exp] 55 / 1e-11 AT2G44840 59 / 4e-12 ethylene-responsive element binding factor 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046700 [exp] 57 / 3e-11 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1) Potri.014G046900 [exp] 53 / 1e-09 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1) Potri.014G047000 [exp] 50 / 6e-09 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1) Potri.014G046600 [exp] 48 / 6e-08 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1) Potri.003G150700 [exp] 48 / 9e-08 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1) Potri.001G079900 [exp] 47 / 1e-07 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1) Potri.014G046800 [exp] 43 / 2e-06 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029332 pacid=23139929 polypeptide=Lus10029332 locus=Lus10029332.g ID=Lus10029332.BGIv1.0 annot-version=v1.0 ATGAAGGGAGCTAAGGCAAAACTAAATTTCCCGCATCTGGTGGGGTCTACTGATTACGAGCCTGTTAGGGTGACTAACAAAAAGCGTGGGTCGCCGGAGC CATCATCCTCCGGGGAGGAGTCGTCGGGGTCGGGAAGTGAATCTCCAAAGGCTAAACGAAGAAAGAGTTTGGTTGACTCGTCGTCCTACGTGGAAGAGGA GTGGGACCAGATCTATTTGGTTAGTCAAATGCCATTTGGCAACGAGCTATTGGCCGGTCAATCGTAA
AA sequence Show only first row Show all	>Lus10029332 pacid=23139929 polypeptide=Lus10029332 locus=Lus10029332.g ID=Lus10029332.BGIv1.0 annot-version=v1.0 MKGAKAKLNFPHLVGSTDYEPVRVTNKKRGSPEPSSSGEESSGSGSESPKAKRRKSLVDSSSYVEEEWDQIYLVSQMPFGNELLAGQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029332 [exp]	0	1
AT2G26975			Ctr copper transporter family ...		Lus10017205 [exp]	5.8	0.8110
AT5G04350			Plant self-incompatibility pro...		Lus10029388 [exp]	5.8	0.8653
					Lus10030558 [exp]	8.2	0.8653
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004042 [exp]	10.1	0.8653
					Lus10022805 [exp]	11.7	0.8653
AT4G05220			Late embryogenesis abundant (L...		Lus10007636 [exp]	12.2	0.7273
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	13.0	0.8653
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10016210 [exp]	13.6	0.7839
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	14.3	0.8653
					Lus10011962 [exp]	15.4	0.8653

Compare expression of checked genes

Lus10029332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.