Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20710 76 / 3e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G60770 58 / 6e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02820 55 / 8e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G15480 54 / 1e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G28020 52 / 4e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21705 51 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G02150 51 / 2e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G01990 48 / 1e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G16890 45 / 1e-06 PPR40 pentatricopeptide (PPR) domain protein 40 (.1) AT2G01390 42 / 2e-05 EMB3111 EMBRYO DEFECTIVE 3111, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016229 [exp] 138 / 2e-40 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10005599 [exp] 125 / 1e-38 AT2G20710 88 / 8e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10029313 [exp] 79 / 1e-18 AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10033698 [exp] 70 / 3e-15 AT2G20710 349 / 4e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10018588 [exp] 62 / 2e-12 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10013047 [exp] 56 / 4e-10 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029043 [exp] 53 / 4e-09 AT5G09450 443 / 1e-154 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021053 [exp] 52 / 5e-09 AT1G02370 494 / 3e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002062 [exp] 50 / 1e-08 AT2G20710 74 / 4e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G063400 [exp] 86 / 8e-21 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132700 [exp] 83 / 9e-20 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132500 [exp] 81 / 3e-19 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.016G063300 [exp] 81 / 4e-19 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G133000 [exp] 63 / 7e-13 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G208900 [exp] 59 / 2e-11 AT4G02820 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G157400 [exp] 57 / 1e-10 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G079600 [exp] 55 / 6e-10 AT1G60770 701 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G120900 [exp] 53 / 2e-09 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G050300 [exp] 52 / 7e-09 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10029335 pacid=23139878 polypeptide=Lus10029335 locus=Lus10029335.g ID=Lus10029335.BGIv1.0 annot-version=v1.0 ATGACAGACAAAAGGCACTACGAACTAAATTCAGGAGATGCTGCAGCAAGGCTGGAATTGATAGCTAAGGATTTCGAAACTCTTCCTCAGCAGCTCAAAG GGATCCACGTTTACAGAGCACTTCTCCGCTGCTACTGTGACGTGCAGTCCGTGGAGAAGGCCGAGGCAGCAATGCAAGAGATGGCGGACTTAGGGATCTA CAAGACGATCTACCATTACAATACCTTACTCGCACTTTACCATCGGATTGGGGATGCGAAGAAGTTTGACGATCTTATCAAGGAGTTGGGACGATTACGG TATTCCATACGGTGTCAAAACGTATAA
AA sequence Show only first row Show all	>Lus10029335 pacid=23139878 polypeptide=Lus10029335 locus=Lus10029335.g ID=Lus10029335.BGIv1.0 annot-version=v1.0 MTDKRHYELNSGDAAARLELIAKDFETLPQQLKGIHVYRALLRCYCDVQSVEKAEAAMQEMADLGIYKTIYHYNTLLALYHRIGDAKKFDDLIKELGRLR YSIRCQNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10029335 [exp]	0	1
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	2.6	0.8279
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	3.7	0.8096
					Lus10040835 [exp]	5.5	0.7854
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10042691 [exp]	5.9	0.7231
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10005758 [exp]	6.7	0.6860
AT4G29035			Plant self-incompatibility pro...		Lus10019767 [exp]	7.4	0.7264
					Lus10009381 [exp]	8.9	0.7453
AT5G25910		AtRLP52	receptor like protein 52 (.1)		Lus10016112 [exp]	10.2	0.7224
AT2G29880			unknown protein		Lus10005028 [exp]	11.0	0.6682
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	13.0	0.7251

Compare expression of checked genes

Lus10029335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.