Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31812 110 / 2e-33 ACBP6, ACBP acyl-CoA-binding protein 6 (.1) AT5G53470 56 / 2e-10 ACBP1 acyl-CoA binding protein 1 (.1) AT4G27780 49 / 6e-08 ACBP2 acyl-CoA binding protein 2 (.1) AT3G05420 48 / 9e-08 ACBP4 acyl-CoA binding protein 4 (.1.2) AT5G27630 45 / 1e-06 ACBP5 acyl-CoA binding protein 5 (.1) AT4G24230 42 / 1e-05 ACBP3 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013605 [exp] 139 / 1e-44 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1) Lus10021246 [exp] 138 / 4e-44 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1) Lus10005910 [exp] 49 / 7e-08 AT4G27780 430 / 3e-151 acyl-CoA binding protein 2 (.1) Lus10029902 [exp] 48 / 9e-08 AT3G05420 1040 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10022382 [exp] 48 / 1e-07 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1) Lus10015176 [exp] 46 / 5e-07 AT3G05420 1024 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10004499 [exp] 45 / 1e-06 AT3G05420 1019 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10031497 [exp] 44 / 2e-06 AT3G05420 1027 / 0.0 acyl-CoA binding protein 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G103700 [exp] 145 / 6e-47 AT1G31812 138 / 2e-44 acyl-CoA-binding protein 6 (.1) Potri.001G130200 [exp] 139 / 1e-44 AT1G31812 140 / 4e-45 acyl-CoA-binding protein 6 (.1) Potri.005G026900 [exp] 51 / 1e-08 AT3G05420 1005 / 0.0 acyl-CoA binding protein 4 (.1.2) Potri.013G018800 [exp] 46 / 4e-07 AT3G05420 999 / 0.0 acyl-CoA binding protein 4 (.1.2) Potri.012G017700 [exp] 45 / 7e-07 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.015G010200 [exp] 45 / 8e-07 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1) Potri.014G018700 [exp] 39 / 0.0001 AT4G24230 133 / 2e-35 acyl-CoA-binding domain 3 (.1.2.3.4.5.6) Potri.002G120200 [exp] 38 / 0.0003 AT4G24230 113 / 3e-28 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0632 [flax] [poplar] FERM_M PF00887 [flax] [poplar] ACBP Acyl CoA binding protein
Representative CDS sequence Show only first row Show all	>Lus10029352 pacid=23139919 polypeptide=Lus10029352 locus=Lus10029352.g ID=Lus10029352.BGIv1.0 annot-version=v1.0 ATGAAAATGGAGGAATTTGAGGAGTATGCTAAGAAGGCATTGGCAATATTGCCAAAGAACACTTCAAACGAGAACAAGCTTATCTTGTATGCACTCTACA AGCAAGCCACTATTGGCCTTGTCAATACCTCGCGGCCAGGGACGTTGAACATGAGGGATAGAGCAAAGTGGGATGCTTGGAAGTCTGCTGAAGGTAAAAC TAAAGATGAAGCAATGAGTGATTACATCACTAAGGTTAAGCAATTGCTGGAAGAAGCTGCTGCTACAAATTGA
AA sequence Show only first row Show all	>Lus10029352 pacid=23139919 polypeptide=Lus10029352 locus=Lus10029352.g ID=Lus10029352.BGIv1.0 annot-version=v1.0 MKMEEFEEYAKKALAILPKNTSNENKLILYALYKQATIGLVNTSRPGTLNMRDRAKWDAWKSAEGKTKDEAMSDYITKVKQLLEEAAATN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Lus10029352 [exp]	0	1

Compare expression of checked genes

Lus10029352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.