Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029354 pacid=23139900 polypeptide=Lus10029354 locus=Lus10029354.g ID=Lus10029354.BGIv1.0 annot-version=v1.0 ATGCCGGAGAAGAAAATCCCTCAGATGCGATCGCACATCGAGAGAAAAGCGCCGGCTATTCCAAACTCATCGGATAGTCACCAACAGCCGGCACCCCCAG CCGGTCTGATGAGGCGACGGAGGGAAAAAGAAAGACAAGAGAAAGAGGAGGATGAAGGAGGAGAAGGATGGAAGAGTCTACACAATACATAG
AA sequence Show only first row Show all	>Lus10029354 pacid=23139900 polypeptide=Lus10029354 locus=Lus10029354.g ID=Lus10029354.BGIv1.0 annot-version=v1.0 MPEKKIPQMRSHIERKAPAIPNSSDSHQQPAPPAGLMRRRREKERQEKEEDEGGEGWKSLHNT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029354 [exp]	0	1
AT2G27920		SCPL51	serine carboxypeptidase-like 5...		Lus10035555 [exp]	15.7	0.7922
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10025729 [exp]	16.2	0.8164
AT3G14520		AtTPS18	Terpenoid cyclases/Protein pre...		Lus10002660 [exp]	18.6	0.8113
AT2G21100			Disease resistance-responsive ...		Lus10027834 [exp]	24.4	0.7981
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10005885 [exp]	25.6	0.7864
AT3G14470			NB-ARC domain-containing disea...		Lus10040208 [exp]	26.9	0.6757
AT5G05340			Peroxidase superfamily protein...		Lus10008581 [exp]	32.0	0.7918
AT3G09890			Ankyrin repeat family protein ...		Lus10022609 [exp]	45.1	0.6447
AT1G04170		EIF2 GAMMA, EIF...	eukaryotic translation initiat...		Lus10020312 [exp]	46.7	0.7170
AT5G15230		GASA4	GAST1 protein homolog 4 (.1.2)		Lus10030680 [exp]	48.9	0.7509

Compare expression of checked genes

Lus10029354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.