Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49540 140 / 2e-44 Rab5-interacting family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016182 [exp] 211 / 1e-71 AT5G49540 140 / 4e-43 Rab5-interacting family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G102200 [exp] 172 / 5e-57 AT5G49540 171 / 1e-56 Rab5-interacting family protein (.1) Potri.010G148600 [exp] 169 / 1e-55 AT5G49540 136 / 6e-43 Rab5-interacting family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07019 [flax] [poplar] Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence Show only first row Show all	>Lus10029365 pacid=23139923 polypeptide=Lus10029365 locus=Lus10029365.g ID=Lus10029365.BGIv1.0 annot-version=v1.0 ATGGCTGTCAGACAAGGTGACTCGAGTTCCTCTGAGAAGAAATCGACTGATGCTTTGAATGATTTGCAGACCTTCAATGCGGAGAACCTACAGAGTAACT TGAAAGTTATCTATTACAGCCGAACATTTCTTTCAATAATTGGTGGCGTAATTGCTGGAATTTTGGGGTTCAAAGGCTTGATAGGATTTGTTTTCTATTT CCTCATCATGGCTATAACTTCTGTGGCACTGGCAGCCAAGGCCAAGTTCTCCATTCACTCCTACTTTGACTCATGGAATCGAGTTGTGCTTGATGGCTTC TTTGGCGGGCTTATGGTATGTTTCTGTTATTTTTCATGA
AA sequence Show only first row Show all	>Lus10029365 pacid=23139923 polypeptide=Lus10029365 locus=Lus10029365.g ID=Lus10029365.BGIv1.0 annot-version=v1.0 MAVRQGDSSSSEKKSTDALNDLQTFNAENLQSNLKVIYYSRTFLSIIGGVIAGILGFKGLIGFVFYFLIMAITSVALAAKAKFSIHSYFDSWNRVVLDGF FGGLMVCFCYFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49540			Rab5-interacting family protei...		Lus10029365 [exp]	0	1
AT1G09150			pseudouridine synthase and arc...		Lus10015197 [exp]	2.2	0.9025
AT2G26990		COP12, ATCSN2, ...	FUSCA 12, CONSTITUTIVE PHOTOMO...		Lus10037417 [exp]	7.6	0.8822
AT5G03430			phosphoadenosine phosphosulfat...		Lus10026539 [exp]	8.8	0.8614
AT3G54970			D-aminoacid aminotransferase-l...		Lus10040366 [exp]	9.2	0.8582
AT4G17010			unknown protein		Lus10001160 [exp]	9.5	0.8718
AT2G16860			GCIP-interacting family protei...		Lus10027464 [exp]	10.5	0.8765
AT5G02930			F-box/RNI-like superfamily pro...		Lus10029589 [exp]	11.0	0.8395
AT1G43860			sequence-specific DNA binding ...		Lus10029749 [exp]	12.3	0.8722
AT2G46230			PIN domain-like family protein...		Lus10012649 [exp]	12.5	0.8660
AT5G30490			unknown protein		Lus10037824 [exp]	13.2	0.8658

Compare expression of checked genes

Lus10029365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.