Lus10029375 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04347 59 / 8e-12 Plant self-incompatibility protein S1 family (.1)
AT5G04350 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
AT4G16295 51 / 1e-08 SPH1 S-protein homologue 1 (.1)
AT3G27680 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT4G29035 50 / 3e-08 Plant self-incompatibility protein S1 family (.1)
AT2G24870 47 / 3e-07 Plant self-incompatibility protein S1 family (.1)
AT3G26880 46 / 6e-07 Plant self-incompatibility protein S1 family (.1)
AT3G26870 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT1G28305 44 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26860 43 / 1e-05 Plant self-incompatibility protein S1 family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029383 109 / 4e-31 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016171 103 / 1e-28 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10016165 94 / 6e-25 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029390 94 / 6e-25 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10029376 92 / 2e-24 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029386 89 / 3e-23 AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029388 88 / 6e-23 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1)
Lus10011892 87 / 3e-22 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10029377 84 / 2e-21 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 102 / 3e-28 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 51 / 8e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 48 / 2e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.003G175000 47 / 4e-07 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 46 / 1e-06 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.001G053100 43 / 1e-05 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 42 / 3e-05 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.001G053200 38 / 0.0005 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
Potri.002G263900 38 / 0.0006 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 38 / 0.0006 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029375 pacid=23139858 polypeptide=Lus10029375 locus=Lus10029375.g ID=Lus10029375.BGIv1.0 annot-version=v1.0
ATGGCGGCGGCCGCCGTGGCCGCGGCGGCGGTGGCAGCAATTCTACTGTCCGCAATTCTGCCGTCATCTGCCGGATTTGTACCGTACTACCATGTCCACA
TCGTCAACAACCTGCGCGGCAAGGTGTTGCTGGTGCGTTGTCGCTCGAGCAACCGGGACCTGGGAGACCAGAACATCCAGGTTGGGTCCGAGTTCGAATG
GAAGCTCCATCGGCAGGTATGGCGATCGACAAACTGGGTGTGTTACCTCGCTCCGGACTACTACCGCCATGCCTTCTTTCAAGCGTACACCGATTTCACT
CCGGATTACAATCACAATGTCTATTGGGTTGCAAAAGAGGACGGGGTTTATGTTAGGGATGGTTCGGGGAAATATGCTGATGTCTTCAAATTCAGATGGG
ACGCTGGCCGAAATCGTCTACATAAGAATACCAATAGTCGTTTATTTTCTTTCTTATGA
AA sequence
>Lus10029375 pacid=23139858 polypeptide=Lus10029375 locus=Lus10029375.g ID=Lus10029375.BGIv1.0 annot-version=v1.0
MAAAAVAAAAVAAILLSAILPSSAGFVPYYHVHIVNNLRGKVLLVRCRSSNRDLGDQNIQVGSEFEWKLHRQVWRSTNWVCYLAPDYYRHAFFQAYTDFT
PDYNHNVYWVAKEDGVYVRDGSGKYADVFKFRWDAGRNRLHKNTNSRLFSFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04347 Plant self-incompatibility pro... Lus10029375 0 1
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10038956 1.7 1.0000
AT5G52605 Defensin-like (DEFL) family pr... Lus10031095 3.5 1.0000
AT5G44950 F-box/RNI-like/FBD-like domain... Lus10018863 4.2 0.8221
AT1G21000 PLATZ transcription factor fam... Lus10005350 4.2 1.0000
AT5G56670 Ribosomal protein S30 family p... Lus10019054 4.9 1.0000
Lus10035508 5.5 1.0000
Lus10034814 6.0 0.9390
Lus10012269 6.0 1.0000
AT4G16640 Matrixin family protein (.1) Lus10037419 6.3 0.9815
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10028506 6.6 0.6137

Lus10029375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.