Lus10029380 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
AT5G38435 47 / 3e-07 SPH8 S-protein homologue 8 (.1)
AT3G10460 46 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT2G24870 43 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT3G27680 43 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26880 43 / 7e-06 Plant self-incompatibility protein S1 family (.1)
AT1G11765 43 / 8e-06 Plant self-incompatibility protein S1 family (.1)
AT5G04347 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT2G06090 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT3G26870 41 / 4e-05 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029378 200 / 3e-67 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029381 156 / 1e-49 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029384 155 / 2e-49 AT5G38435 51 / 1e-08 S-protein homologue 8 (.1)
Lus10029385 152 / 2e-48 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Lus10029379 152 / 4e-48 AT5G38435 47 / 2e-07 S-protein homologue 8 (.1)
Lus10029376 148 / 9e-47 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029383 133 / 1e-40 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016165 130 / 6e-40 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029377 114 / 3e-33 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 57 / 6e-11 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 57 / 9e-11 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.004G199700 47 / 3e-07 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.003G201300 44 / 4e-06 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029380 pacid=23139779 polypeptide=Lus10029380 locus=Lus10029380.g ID=Lus10029380.BGIv1.0 annot-version=v1.0
ATGACATTCAAGACTCTGTCACTTGCCATCGTGGTAGCGACATTTTTGCTGGCCACAACAATTCCTCCATCATCGTCGGACGACTGGGGGCCGTTTAATC
GGAATAGATACTATGTCCACATCATAAACGAGCTTAGCAGGAACAAAGTTTTGACGGCACAATGCAACTGTGTAGACAACCCTCAGCCAGTCACTTACGT
CAAGGCCGGAGCTGAGTATAAGTTAACTTTCAGGGAACATTTGTTTCGAGCGACACGTTGGTCGTGCAACCTTATTGCAGACAAAAATCGTCACGTGTGG
TTTGTGGCCTATTATGAAGACATCCAAAGTTTTGACTTCAACGTTTATTGGGCTGCTAGAGAAGACGGTGTATACTTCAGGAATCCTGATGGCCCTGATA
CCTTTCAATTTTAA
AA sequence
>Lus10029380 pacid=23139779 polypeptide=Lus10029380 locus=Lus10029380.g ID=Lus10029380.BGIv1.0 annot-version=v1.0
MTFKTLSLAIVVATFLLATTIPPSSSDDWGPFNRNRYYVHIINELSRNKVLTAQCNCVDNPQPVTYVKAGAEYKLTFREHLFRATRWSCNLIADKNRHVW
FVAYYEDIQSFDFNVYWAAREDGVYFRNPDGPDTFQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04350 Plant self-incompatibility pro... Lus10029380 0 1

Lus10029380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.