Lus10029382 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029388 82 / 2e-21 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029387 79 / 2e-20 AT5G04350 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Lus10029375 79 / 4e-20 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029378 78 / 5e-20 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10016171 76 / 7e-19 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029386 75 / 8e-19 AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029376 74 / 2e-18 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029389 74 / 4e-18 AT2G06090 40 / 2e-04 Plant self-incompatibility protein S1 family (.1)
Lus10029380 72 / 2e-17 AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 52 / 1e-09 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029382 pacid=23139782 polypeptide=Lus10029382 locus=Lus10029382.g ID=Lus10029382.BGIv1.0 annot-version=v1.0
ATGAACGAGCTCGCAAGCGACACGTTGCTCGTGCACTGTCACTGCATCAACCACGACGATGGAGAGCACAACATCAACGTCGGGACTGAGTACGATTTGG
TGTTCAGGAAGCATGTGTTCCGGCAGAATCTCTGGCAGTGTACCCTTGTTCCGGACAAGTTTCGCCAAGTGTATCTTCATGCCTGCGACGATTATACGGG
AGATTACGATTACAATGCTTATTGGGCTGTTAAAGAGGATGGGATCTAG
AA sequence
>Lus10029382 pacid=23139782 polypeptide=Lus10029382 locus=Lus10029382.g ID=Lus10029382.BGIv1.0 annot-version=v1.0
MNELASDTLLVHCHCINHDDGEHNINVGTEYDLVFRKHVFRQNLWQCTLVPDKFRQVYLHACDDYTGDYDYNAYWAVKEDGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029382 0 1

Lus10029382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.