Lus10029383 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04350 61 / 2e-12 Plant self-incompatibility protein S1 family (.1)
AT5G38435 49 / 4e-08 SPH8 S-protein homologue 8 (.1)
AT1G28305 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04347 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT3G27680 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT3G10460 47 / 5e-07 Plant self-incompatibility protein S1 family (.1)
AT4G10895 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
AT4G16295 45 / 2e-06 SPH1 S-protein homologue 1 (.1)
AT4G29035 44 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26860 42 / 2e-05 Plant self-incompatibility protein S1 family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029376 134 / 9e-41 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029377 124 / 5e-37 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Lus10016165 121 / 8e-36 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029378 120 / 2e-35 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029380 118 / 1e-34 AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
Lus10016171 109 / 5e-31 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029375 109 / 6e-31 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016168 108 / 1e-30 AT5G38435 51 / 9e-09 S-protein homologue 8 (.1)
Lus10029385 107 / 3e-30 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 77 / 2e-18 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 56 / 3e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199700 54 / 9e-10 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.004G199801 52 / 6e-09 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.010G008300 47 / 4e-07 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 43 / 8e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029383 pacid=23139954 polypeptide=Lus10029383 locus=Lus10029383.g ID=Lus10029383.BGIv1.0 annot-version=v1.0
ATGTTCTCTTCCTCCGACACCCGACCCAAGAGTCCCGCACGACCGATCACTATTGTCGTTGTCGCGGTAGCAACACTACTACTTGCGACGAGCCCTCCAG
CATCGGCCTGGTCGCTATGGCATCCTCCACACTACCATGTCCACATCGTAAACGAGCTCAAGGGCCACAAGGTGTTGGTGGTGCAGTGTCGATGTACTGA
CGCGCCTGAGCCAATCACTCTCGTCAAAGCTGGAAAAGAGTACGTCTTTTCGTTCAAGGAACATATTTTTCGAGACACGCTTTGGACATGCTACCTTTCT
CCAGACAATCATCGCCATGTTAGTTTCGTAGCCTATGAGAACGAGACCCCAAGTTTGGAGCGAAATGTCGTTTGGGCTGTTAAAGAGGACGGGGTCTATT
TTCGAGACGGTCGAAGGGGCTTTGGAGATTTGTTCTTATATAAATGGGAACATGGTCGCCTGCCTAATTAA
AA sequence
>Lus10029383 pacid=23139954 polypeptide=Lus10029383 locus=Lus10029383.g ID=Lus10029383.BGIv1.0 annot-version=v1.0
MFSSSDTRPKSPARPITIVVVAVATLLLATSPPASAWSLWHPPHYHVHIVNELKGHKVLVVQCRCTDAPEPITLVKAGKEYVFSFKEHIFRDTLWTCYLS
PDNHRHVSFVAYENETPSLERNVVWAVKEDGVYFRDGRRGFGDLFLYKWEHGRLPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04350 Plant self-incompatibility pro... Lus10029383 0 1
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10001774 3.7 1.0000
Lus10001326 5.0 1.0000
Lus10004351 5.7 1.0000
Lus10033811 7.9 1.0000
AT2G33470 ATGLTP1, GLTP1 ARABIDOPSIS GLYCOLIPID TRANSFE... Lus10008244 8.4 1.0000
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10013823 8.4 1.0000
Lus10027374 8.5 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 9.2 1.0000
AT3G57030 Calcium-dependent phosphotries... Lus10009015 9.2 1.0000
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10036445 10.9 1.0000

Lus10029383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.