Lus10029386 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT5G04347 50 / 1e-08 Plant self-incompatibility protein S1 family (.1)
AT4G16295 47 / 4e-07 SPH1 S-protein homologue 1 (.1)
AT1G28305 46 / 6e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04350 46 / 6e-07 Plant self-incompatibility protein S1 family (.1)
AT1G11765 44 / 5e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26880 44 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26870 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT5G39493 39 / 0.0002 Plant self-incompatibility protein S1 family (.1)
AT3G26860 39 / 0.0003 Plant self-incompatibility protein S1 family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029389 167 / 7e-54 AT2G06090 40 / 2e-04 Plant self-incompatibility protein S1 family (.1)
Lus10029387 150 / 2e-47 AT5G04350 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Lus10029388 128 / 1e-38 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029390 116 / 7e-34 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10016171 100 / 1e-27 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029375 89 / 3e-23 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016165 88 / 6e-23 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029383 86 / 8e-22 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029377 82 / 2e-20 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 67 / 8e-15 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 54 / 8e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199801 51 / 2e-08 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.004G199700 45 / 2e-06 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.010G008300 44 / 4e-06 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 40 / 0.0001 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 39 / 0.0003 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 39 / 0.0003 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029386 pacid=23139890 polypeptide=Lus10029386 locus=Lus10029386.g ID=Lus10029386.BGIv1.0 annot-version=v1.0
ATGCTCCTCTCCTCCTCGTCCAAGCCTCTATTGGTCCTGATGCTAGCGATGCCGGTTCTTCTAGCAACGCTTAGTTCGTCGGCAAGTGTACAATACGGCC
CAACCATTGCCGCTCACGTAAAAAATGAGCTCAATCCGGGTAAGGTGTTGTACGTGCGTTGTCATTGCAACGACCATGATTTGGGAGATCAGTACATCAA
CGTCGGGGCCGAGTTCACTTGGACGTTCCACCCACATTTCATCAAGAAGAATCTCTGGCAGTGCTACATCGCTCCGGACAGCAACCACCACGCTTATTTC
CATGTGTACGATAACAAATCTCCGAGCTACGATTTCGATTTTGTTTTCGCGGCTAAAGAGGACGGGGTCTATTATAGGAACCAAGACAGTCACGAAGATG
AATTCTTCTCCAATTATCTGCCTGGCAAGCTGATTCATTGA
AA sequence
>Lus10029386 pacid=23139890 polypeptide=Lus10029386 locus=Lus10029386.g ID=Lus10029386.BGIv1.0 annot-version=v1.0
MLLSSSSKPLLVLMLAMPVLLATLSSSASVQYGPTIAAHVKNELNPGKVLYVRCHCNDHDLGDQYINVGAEFTWTFHPHFIKKNLWQCYIAPDSNHHAYF
HVYDNKSPSYDFDFVFAAKEDGVYYRNQDSHEDEFFSNYLPGKLIH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29035 Plant self-incompatibility pro... Lus10029386 0 1

Lus10029386 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.