Lus10029388 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT5G04350 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT5G04347 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
AT4G16295 48 / 1e-07 SPH1 S-protein homologue 1 (.1)
AT3G10460 45 / 8e-07 Plant self-incompatibility protein S1 family (.1)
AT2G24870 45 / 1e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26880 44 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT1G09245 43 / 1e-05 Plant self-incompatibility protein S1 family (.1)
AT3G55677 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT3G55252 41 / 6e-05 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029386 133 / 8e-41 AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029389 129 / 3e-39 AT2G06090 40 / 2e-04 Plant self-incompatibility protein S1 family (.1)
Lus10029387 118 / 1e-34 AT5G04350 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Lus10016165 110 / 6e-32 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029390 106 / 4e-30 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10016171 102 / 1e-28 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029383 98 / 9e-27 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016168 96 / 4e-26 AT5G38435 51 / 9e-09 S-protein homologue 8 (.1)
Lus10029377 96 / 5e-26 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 81 / 4e-20 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 54 / 6e-10 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 52 / 4e-09 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.002G252500 47 / 3e-07 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.003G175000 47 / 3e-07 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 45 / 2e-06 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 44 / 4e-06 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.018G148366 43 / 5e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 40 / 9e-05 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029388 pacid=23139777 polypeptide=Lus10029388 locus=Lus10029388.g ID=Lus10029388.BGIv1.0 annot-version=v1.0
ATGACAGGATCGCTCTTTGTGCTGATGCTAGTGGTGCCAATGCTGTTGGCCACGGTAAGTTCGTGGCCGGTAGTAAATGGCAACGGTGACATCGATATGC
ACGTAAGAAACGAGCTTGATGCAGGGCGGGTGTTAAACGTGCATTGTCATTGCACGGACCACGATCTGGGGAACACCAAGATCAAAGTTGGGGCCGAGTA
CTATTGGAGGTTCAAAACGCATTTCATCAGAAAGAACCTCTGGCAGTGTTACCTTGTTCCGGACACTCATCGCTACGCGTATTTTCACGTCTTCGATGAG
GATACTCCAGGTGATGAAGAGAATATTTTTTGGGTTGCTAAGGAGGACGGGATCTATTATAGGTACCCGGACACTTCGAAAGACGAGTTCAGATACAAAT
GGGACTCGAAAGTGTAG
AA sequence
>Lus10029388 pacid=23139777 polypeptide=Lus10029388 locus=Lus10029388.g ID=Lus10029388.BGIv1.0 annot-version=v1.0
MTGSLFVLMLVVPMLLATVSSWPVVNGNGDIDMHVRNELDAGRVLNVHCHCTDHDLGNTKIKVGAEYYWRFKTHFIRKNLWQCYLVPDTHRYAYFHVFDE
DTPGDEENIFWVAKEDGIYYRYPDTSKDEFRYKWDSKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04350 Plant self-incompatibility pro... Lus10029388 0 1
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10004042 2.6 1.0000
Lus10011962 3.7 1.0000
AT2G20340 Pyridoxal phosphate (PLP)-depe... Lus10012601 4.6 1.0000
Lus10022805 5.3 1.0000
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029332 5.8 0.8653
AT5G05530 RING/U-box superfamily protein... Lus10024629 5.9 1.0000
AT2G15220 Plant basic secretory protein ... Lus10026579 6.5 1.0000
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10014637 7.0 1.0000
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10030911 7.9 1.0000
Lus10030558 8.0 1.0000

Lus10029388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.