Lus10029390 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16295 71 / 5e-16 SPH1 S-protein homologue 1 (.1)
AT4G29035 66 / 2e-14 Plant self-incompatibility protein S1 family (.1)
AT5G04347 55 / 4e-10 Plant self-incompatibility protein S1 family (.1)
AT5G04350 49 / 7e-08 Plant self-incompatibility protein S1 family (.1)
AT4G16195 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT3G26880 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT5G38435 46 / 5e-07 SPH8 S-protein homologue 8 (.1)
AT3G10460 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
AT1G11765 45 / 1e-06 Plant self-incompatibility protein S1 family (.1)
AT5G04047 44 / 4e-06 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016171 121 / 9e-36 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10029385 120 / 2e-35 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Lus10029386 120 / 3e-35 AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029383 119 / 6e-35 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029384 114 / 7e-33 AT5G38435 51 / 1e-08 S-protein homologue 8 (.1)
Lus10029387 112 / 2e-32 AT5G04350 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Lus10029376 111 / 7e-32 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029389 110 / 1e-31 AT2G06090 40 / 2e-04 Plant self-incompatibility protein S1 family (.1)
Lus10029380 110 / 1e-31 AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 100 / 4e-27 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 69 / 3e-15 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199801 62 / 2e-12 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.004G199700 59 / 9e-12 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.003G201300 53 / 2e-09 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 51 / 1e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 48 / 3e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 46 / 8e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 42 / 3e-05 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 40 / 8e-05 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029390 pacid=23139875 polypeptide=Lus10029390 locus=Lus10029390.g ID=Lus10029390.BGIv1.0 annot-version=v1.0
ATGTACTCCCAGCCTACCATCGCAATTGCGGTGGCAGTTGTACTAATGGGAACAATCCCTCCATCGTCGGCGGCGATCTTTCCCTTCATTCACTACCATG
GACACATCGTGAACGAGCTGAGCGCAAACAAGGTGTTGTTGGTGGACTGCCAGTGCAGCGACCACGATCTGGGAGACAATTATGTCAAAGTTGGAGGCGA
GTTCCGGTGGTCGTTCAAGCCACATTTATTTAGGCAGACACTATGGCACTGTTACCTCGATCCAGACCGTAATAGTCACGCCTATATTGTAGCCTATGTT
GATGACATGAAGAATGTTGATAAGCACCGCAATTTTATTTGGGTTGCGAAAGATGACGGGGTTTATGCGAGGAACCCTGAGTCCCATGAAGATTACTTCT
CTTATGCATGGAAACCTGGCCACCTACACCTTGCCCGACGTTACATCTCTGATTGA
AA sequence
>Lus10029390 pacid=23139875 polypeptide=Lus10029390 locus=Lus10029390.g ID=Lus10029390.BGIv1.0 annot-version=v1.0
MYSQPTIAIAVAVVLMGTIPPSSAAIFPFIHYHGHIVNELSANKVLLVDCQCSDHDLGDNYVKVGGEFRWSFKPHLFRQTLWHCYLDPDRNSHAYIVAYV
DDMKNVDKHRNFIWVAKDDGVYARNPESHEDYFSYAWKPGHLHLARRYISD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 0 1
Lus10000400 1.0 1.0000
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 2.0 1.0000
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 2.4 1.0000
AT5G19580 glyoxal oxidase-related protei... Lus10043230 3.0 0.9620
AT5G18460 Protein of Unknown Function (D... Lus10006860 3.5 1.0000
AT3G45600 TET3 tetraspanin3 (.1) Lus10023218 3.7 0.9926
AT5G47550 Cystatin/monellin superfamily ... Lus10034773 3.9 0.9115
Lus10009372 3.9 1.0000
AT4G29280 LCR22 low-molecular-weight cysteine-... Lus10015983 4.2 1.0000
AT2G27930 PLATZ transcription factor fam... Lus10036044 4.5 0.9397

Lus10029390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.