Lus10029391 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029390 62 / 1e-12 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10029375 62 / 2e-12 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029377 55 / 6e-10 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Lus10016165 48 / 1e-07 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10016171 48 / 2e-07 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10011895 48 / 3e-07 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10029388 46 / 1e-06 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1)
Lus10016167 45 / 1e-06 ND 37 / 6e-04
Lus10016168 45 / 2e-06 AT5G38435 51 / 9e-09 S-protein homologue 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 53 / 4e-09 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10029391 pacid=23139962 polypeptide=Lus10029391 locus=Lus10029391.g ID=Lus10029391.BGIv1.0 annot-version=v1.0
ATGTTCTCTTCGTCCATCTCCCAGTTTAGAGCTCTCGTCGCAGTCATCGTAGCTGTGACAGTACTACTACTGTCGGCGGTCCCGCCATCCTCGTCAGCAA
AACCCGTTCCCTCGAATACCTACACTGCCCATGTCGTGAACCATGGCGCGAACAAGGTGATTCTGGTCCGATGCAACTCTAACCAAGGCAGCCAGGTGGA
GGAGTCCGTGAACGTCGACCTAGAGCTTGCGTGGTCGTTCAAGGCGGACGAGAACACGTCCTGGAGGTGTTACGTCGCCACCACTAATAAGCACAAGGAT
TTCGTTATCTTCGGTCCTGGTCGGGACTGGACTCCGGTCCTCGATAGGCAGCACAACTTCTACTGGCTGGCGGAATCCAACGGCATCTTTTTGAAGAACC
CTGTGAGCGGATCGGAATCGTTGGCTTATCGGTGGGATCAGGGTGGTGTCGCTGAGCTAGCCTGA
AA sequence
>Lus10029391 pacid=23139962 polypeptide=Lus10029391 locus=Lus10029391.g ID=Lus10029391.BGIv1.0 annot-version=v1.0
MFSSSISQFRALVAVIVAVTVLLLSAVPPSSSAKPVPSNTYTAHVVNHGANKVILVRCNSNQGSQVEESVNVDLELAWSFKADENTSWRCYVATTNKHKD
FVIFGPGRDWTPVLDRQHNFYWLAESNGIFLKNPVSGSESLAYRWDQGGVAELA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029391 0 1
AT3G05610 Plant invertase/pectin methyle... Lus10015211 4.6 0.9652
AT5G60010 ferric reductase-like transmem... Lus10019390 6.9 0.9603
AT1G04670 unknown protein Lus10004041 8.5 0.9603
Lus10040397 9.8 0.9603
Lus10006918 11.0 0.9603
Lus10007508 12.0 0.9603
AT3G53690 RING/U-box superfamily protein... Lus10042610 13.0 0.9603
Lus10027066 13.9 0.9603
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009516 14.7 0.9603
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 15.5 0.9603

Lus10029391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.