Lus10029394 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004190 103 / 1e-29 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029394 pacid=23139781 polypeptide=Lus10029394 locus=Lus10029394.g ID=Lus10029394.BGIv1.0 annot-version=v1.0
ATGGCATTACAACCCCCCTTCACCTTGGAGTTCATGGCAATTCGTAGAGCTCTCTCTGAGGCGTCGTATTGGCTTCCTGCGGCGGCGGTTGCTATGGGGT
ACTGGAAATATATCTTCGCAGACTACGCGAAATGGATTGCCTGCTGCTCATTCTTCGTTGCGATGAGAGAAATCAGCCGCCGCGATCTTGACACTCCTTC
TTGGATCTTGGCATTTGGGGGTTGTATTGTGCTGTATGGACTGGCGATCTGCTACTTCGGCGAGGTCAAGCACCGGAATTTGCGCGCTCCGGCTCCGGCG
GCCGGAGAAGAAGAGGAAGATCTTGAAGAGAATGAAAAGACGCCTCTCCTGGCGGAAGGAGGAAAAGCTTTAGGAGTTCCAGGATTGAATCGATCTGTTG
TTAGTAACTAG
AA sequence
>Lus10029394 pacid=23139781 polypeptide=Lus10029394 locus=Lus10029394.g ID=Lus10029394.BGIv1.0 annot-version=v1.0
MALQPPFTLEFMAIRRALSEASYWLPAAAVAMGYWKYIFADYAKWIACCSFFVAMREISRRDLDTPSWILAFGGCIVLYGLAICYFGEVKHRNLRAPAPA
AGEEEEDLEENEKTPLLAEGGKALGVPGLNRSVVSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029394 0 1
AT2G47640 Small nuclear ribonucleoprotei... Lus10026556 1.0 0.9339
AT2G47640 Small nuclear ribonucleoprotei... Lus10030367 2.0 0.9051
AT5G43460 HR-like lesion-inducing protei... Lus10041152 3.2 0.8803
AT2G47640 Small nuclear ribonucleoprotei... Lus10013840 4.0 0.8824
AT4G15950 RDM2, NRPE4, NR... RNA-DIRECTED DNA METHYLATION 2... Lus10039097 5.2 0.8966
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10023091 5.5 0.8916
AT3G02080 Ribosomal protein S19e family ... Lus10010339 5.7 0.8934
AT2G02470 Alfin AL6 alfin-like 6 (.1.2) Lus10026269 6.5 0.8763
AT5G14640 ATSK13 shaggy-like kinase 13 (.1) Lus10013088 6.5 0.8834
AT1G18720 Protein of unknown function (D... Lus10021661 6.8 0.8458

Lus10029394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.