Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38495 100 / 4e-29 unknown protein AT2G36740 45 / 1e-06 ATSWC2 sequence-specific DNA binding transcription factors;DNA binding;DNA binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004196 [exp] 131 / 5e-41 AT4G38495 166 / 2e-54 unknown protein Lus10020396 [exp] 44 / 3e-06 AT2G36740 411 / 1e-143 sequence-specific DNA binding transcription factors;DNA binding;DNA binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G127200 [exp] 120 / 1e-36 AT4G38495 167 / 1e-54 unknown protein Potri.001G412800 [exp] 44 / 1e-06 AT2G36740 350 / 7e-120 sequence-specific DNA binding transcription factors;DNA binding;DNA binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08265 [flax] [poplar] YL1_C YL1 nuclear protein C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10029400 pacid=23139918 polypeptide=Lus10029400 locus=Lus10029400.g ID=Lus10029400.BGIv1.0 annot-version=v1.0 ATGATCCGAATTTCACTTGCTTCCTGGGATTTTTACTCTTTATACTGCCCTGGTGGTGATGTTGCAGATATTAATATCGAATCGCCACCATCCATGCACC CGTCGAAGAAGATTTGCGACATTACAGGATTCGAGGCGCCTTATGTGGATCCGAGGACGAACCTGCGATATGCAAACACGGAGGTGTTCAAGCAAATAAG GGGACTTCCTAATGAGTATGTGCAGAGGTATCTGGCTCTAAGGAATGCTGCAGTTGTTCTGAAATAG
AA sequence Show only first row Show all	>Lus10029400 pacid=23139918 polypeptide=Lus10029400 locus=Lus10029400.g ID=Lus10029400.BGIv1.0 annot-version=v1.0 MIRISLASWDFYSLYCPGGDVADINIESPPSMHPSKKICDITGFEAPYVDPRTNLRYANTEVFKQIRGLPNEYVQRYLALRNAAVVLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38495			unknown protein		Lus10029400 [exp]	0	1
AT3G52230			unknown protein		Lus10038643 [exp]	3.2	0.8546
AT3G19290	bZIP	AREB2, ABF4	ABA-RESPONSIVE ELEMENT BINDING...		Lus10002399 [exp]	4.9	0.8210
AT1G29850			double-stranded DNA-binding fa...		Lus10004540 [exp]	7.3	0.8270
AT3G61790			Protein with RING/U-box and TR...		Lus10002761 [exp]	9.2	0.7978
AT1G11760		MED32	unknown protein		Lus10034758 [exp]	11.6	0.8163
AT3G62920			unknown protein		Lus10005942 [exp]	11.6	0.7714
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10023134 [exp]	12.4	0.8032
AT3G27050			unknown protein		Lus10035208 [exp]	12.6	0.8061
AT5G26040		HDA2	histone deacetylase 2 (.1.2)		Lus10024990 [exp]	13.9	0.8199
AT2G39445			Phosphatidylinositol N-acetylg...		Lus10003796 [exp]	15.7	0.6953

Compare expression of checked genes

Lus10029400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.