Lus10029412 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04390 226 / 1e-77 Ribosomal S17 family protein (.1)
AT2G05220 225 / 2e-77 Ribosomal S17 family protein (.1.2)
AT5G04800 224 / 6e-77 Ribosomal S17 family protein (.1.2.3.4)
AT3G10610 221 / 9e-76 Ribosomal S17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004208 253 / 4e-88 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1)
Lus10021307 240 / 5e-83 AT5G04800 231 / 9e-80 Ribosomal S17 family protein (.1.2.3.4)
Lus10041076 220 / 3e-75 AT5G04800 226 / 8e-78 Ribosomal S17 family protein (.1.2.3.4)
Lus10030344 223 / 4e-71 AT1G80560 655 / 0.0 ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 2, isopropylmalate dehydrogenase 2 (.1)
Lus10016985 146 / 2e-46 AT3G10610 143 / 1e-45 Ribosomal S17 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G017300 227 / 4e-78 AT5G04800 229 / 1e-78 Ribosomal S17 family protein (.1.2.3.4)
Potri.010G241200 227 / 5e-78 AT5G04800 228 / 2e-78 Ribosomal S17 family protein (.1.2.3.4)
Potri.016G073750 172 / 2e-56 AT5G04800 171 / 5e-56 Ribosomal S17 family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00833 Ribosomal_S17e Ribosomal S17
Representative CDS sequence
>Lus10029412 pacid=23139847 polypeptide=Lus10029412 locus=Lus10029412.g ID=Lus10029412.BGIv1.0 annot-version=v1.0
ATGGGACGCGTCCGAACCAAGACCGTGAAGAAGTCCTCCCGCCAGGTGATCGAGCGCTACTACTCGAAAATGACGCTGGATTTCCACACCAACAAGAAGA
TCCTCGAGGAAGTGGCCATCATCCCATCGAAGCGCCTCCGCAACAAGATCGCCGGATTCTCCACTCACCTGATGAAGCGGATCCAGAAGGGCCCTGTCCG
CGGGATCTCCCTCAAGCTCCAGGAGGAAGAGCGCGAGCGCCGCATGGACTTCGTCCCCGAGGAGTCAGCAATCAGGACCGACGAGATCAAGGTCGACAAG
GAGACTAAGGAGATGCTTGCTGCTCTTGGCATGGCCGATATCGGAGGTATAGTCGAGGTCGATCCTATTGCCGTCTCTGCCCCTCCGTTCGGGTTTGGGA
GAGGCGCTGGCCGTGGGAGGTACTGA
AA sequence
>Lus10029412 pacid=23139847 polypeptide=Lus10029412 locus=Lus10029412.g ID=Lus10029412.BGIv1.0 annot-version=v1.0
MGRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPEESAIRTDEIKVDK
ETKEMLAALGMADIGGIVEVDPIAVSAPPFGFGRGAGRGRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04390 Ribosomal S17 family protein (... Lus10029412 0 1
AT2G04390 Ribosomal S17 family protein (... Lus10004208 2.0 0.9686
AT3G09630 Ribosomal protein L4/L1 family... Lus10014431 5.7 0.9447
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Lus10012833 8.1 0.9418
AT3G13920 RH4, TIF4A1, EI... eukaryotic translation initiat... Lus10017153 8.7 0.9379
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10004617 11.5 0.9375
AT2G43770 Transducin/WD40 repeat-like su... Lus10012230 14.5 0.9270
AT4G15770 RNA binding (.1) Lus10037509 14.5 0.9197
AT5G35530 Ribosomal protein S3 family pr... Lus10030502 16.1 0.9376
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Lus10011317 19.4 0.9239
AT3G57490 Ribosomal protein S5 family pr... Lus10027358 19.9 0.9376

Lus10029412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.