Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44260 106 / 2e-29 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G22250 103 / 2e-28 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT2G32070 93 / 2e-24 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G10960 87 / 7e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G80780 86 / 1e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) AT1G15920 81 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2) AT1G06450 57 / 1e-10 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27890 53 / 2e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27820 51 / 1e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G61470 48 / 1e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004212 [exp] 179 / 1e-57 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10021304 [exp] 133 / 2e-39 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10016980 [exp] 133 / 5e-39 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10034180 [exp] 102 / 1e-27 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10003635 [exp] 100 / 8e-27 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10036291 [exp] 95 / 6e-25 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017123 [exp] 90 / 4e-23 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10018330 [exp] 90 / 4e-23 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017895 [exp] 61 / 1e-12 AT1G06450 98 / 4e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G205600 [exp] 118 / 9e-34 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.016G073000 [exp] 112 / 1e-31 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.004G200400 [exp] 103 / 4e-28 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.009G161500 [exp] 102 / 1e-27 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G187200 [exp] 95 / 7e-25 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G046700 [exp] 92 / 5e-24 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.003G181100 [exp] 92 / 8e-24 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) Potri.006G262500 [exp] 89 / 2e-22 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.018G020900 [exp] 87 / 5e-22 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.003G186300 [exp] 78 / 2e-18 AT5G22250 261 / 9e-87 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF04857 [flax] [poplar] CAF1 CAF1 family ribonuclease
Representative CDS sequence Show only first row Show all	>Lus10029416 pacid=23139867 polypeptide=Lus10029416 locus=Lus10029416.g ID=Lus10029416.BGIv1.0 annot-version=v1.0 ATGACCCGTTCGGTGTGGGCGGAGAATCTGGAGTCCGAGTTCGCCGTCATCATCTCCGTCGCCAAGGACTATCCGCTGATATCCATGGATACGGAGTTCC CCGGCGTGGTCATACGGCCACCGGGAGTCGAGCAGGCCAACATCCGGCTTCAAGATCCGACGGCGCGGTACGCGAGCCTAAAGGCCAACGTCGATTCGCT CAAACTGATCCAGGTAGGGCTCACCGTAGCCGACCGAGACGGCAATCTACCGGATCTTGGTGGCGGTAGCTTCCGTCGATCTACTGAGGAGGCAAGGGAT CGATTTCGAGAAAAATCGTAA
AA sequence Show only first row Show all	>Lus10029416 pacid=23139867 polypeptide=Lus10029416 locus=Lus10029416.g ID=Lus10029416.BGIv1.0 annot-version=v1.0 MTRSVWAENLESEFAVIISVAKDYPLISMDTEFPGVVIRPPGVEQANIRLQDPTARYASLKANVDSLKLIQVGLTVADRDGNLPDLGGGSFRRSTEEARD RFREKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44260		AtCAF1a	CCR4- associated factor 1a, Po...		Lus10029416 [exp]	0	1
AT3G19130		ATRBP47B	RNA-binding protein 47B (.1)		Lus10019889 [exp]	13.1	0.8491
AT3G44260		AtCAF1a	CCR4- associated factor 1a, Po...		Lus10004212 [exp]	21.2	0.8484
AT2G45010			PLAC8 family protein (.1.2)		Lus10027214 [exp]	23.1	0.8218
AT5G49400			zinc knuckle (CCHC-type) famil...		Lus10016879 [exp]	24.2	0.8087
AT3G04580		EIN4	ETHYLENE INSENSITIVE 4, Signal...		Lus10006574 [exp]	25.7	0.8220
AT3G60540			Preprotein translocase Sec, Se...		Lus10011428 [exp]	29.1	0.8407
AT5G57900		SKIP1	SKP1 interacting partner 1 (.1...		Lus10019104 [exp]	56.3	0.7797
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Lus10004946 [exp]	57.2	0.8077
AT1G23800		ALDH2B7	aldehyde dehydrogenase 2B7 (.1...		Lus10012999 [exp]	64.5	0.8050
AT1G26270			Phosphatidylinositol 3- and 4-...		Lus10000011 [exp]	66.1	0.8063

Compare expression of checked genes

Lus10029416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.