Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22250 151 / 1e-46 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G44260 150 / 4e-46 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G10960 122 / 2e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT2G32070 120 / 2e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G15920 116 / 9e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2) AT1G80780 114 / 3e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) AT1G61470 58 / 5e-11 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27820 53 / 4e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27890 52 / 7e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G06450 50 / 3e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004212 [exp] 236 / 2e-79 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10021304 [exp] 205 / 2e-67 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10016980 [exp] 207 / 4e-67 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10034180 [exp] 157 / 9e-49 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10018330 [exp] 122 / 3e-35 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017123 [exp] 122 / 4e-35 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10036291 [exp] 119 / 7e-34 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10003635 [exp] 115 / 2e-32 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10029713 [exp] 58 / 7e-11 AT5G10960 144 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G205600 [exp] 166 / 4e-52 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.016G073000 [exp] 161 / 4e-50 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.009G161500 [exp] 157 / 1e-48 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.004G200400 [exp] 154 / 1e-47 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G187200 [exp] 127 / 5e-37 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G046700 [exp] 122 / 3e-35 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.018G020900 [exp] 121 / 7e-35 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.003G181100 [exp] 120 / 2e-34 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) Potri.006G262500 [exp] 120 / 2e-34 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G038500 [exp] 106 / 1e-29 AT5G22250 213 / 7e-69 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF04857 [flax] [poplar] CAF1 CAF1 family ribonuclease
Representative CDS sequence Show only first row Show all	>Lus10029417 pacid=23139884 polypeptide=Lus10029417 locus=Lus10029417.g ID=Lus10029417.BGIv1.0 annot-version=v1.0 ATGACTTCCGGGCTGGTCCTGACCGATTCGGTCAGCTGGGTGACGTTCCACAGCGCTTACGACTTTGGTTACCTGGTCAAGTGTCTGACTCAGCGGCCTC TGCCGGACAGATTGGACGATTTCCTCGACATTGTGAGGATGTTCTTCGGGGCTAGGGTTTACGACGTGAAGCATCTGATGAAGTTTGGGGCGAATTTGTA CGGCGGATTGGATAGGACGTGCACCACTCTGGGTGTGAAGAGGGTTACTGGGAAGAGTCACCAAGCTGGCTCGGATAGTTTGGCCACTCTCCATGCTTTC CAGAAGATGAGAGAGATGTACTTCAGCGATGGCGCAATGGAGAAGTACGCCAATGTGCTATACGGGTTAGAACTGTTGGCTTCATAA
AA sequence Show only first row Show all	>Lus10029417 pacid=23139884 polypeptide=Lus10029417 locus=Lus10029417.g ID=Lus10029417.BGIv1.0 annot-version=v1.0 MTSGLVLTDSVSWVTFHSAYDFGYLVKCLTQRPLPDRLDDFLDIVRMFFGARVYDVKHLMKFGANLYGGLDRTCTTLGVKRVTGKSHQAGSDSLATLHAF QKMREMYFSDGAMEKYANVLYGLELLAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22250		AtCAF1b	CCR4- associated factor 1b, Po...		Lus10029417 [exp]	0	1
AT3G44260		AtCAF1a	CCR4- associated factor 1a, Po...		Lus10004212 [exp]	1.0	0.9590
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10022019 [exp]	3.5	0.9487
AT5G10750			Protein of unknown function (D...		Lus10026242 [exp]	4.0	0.9359
AT1G69310	WRKY	ATWRKY57, WRKY5...	WRKY DNA-binding protein 57 (....		Lus10037094 [exp]	5.6	0.9146
AT5G13110		G6PD2	glucose-6-phosphate dehydrogen...		Lus10003134 [exp]	5.7	0.9468
AT1G32440		PKP3	plastidial pyruvate kinase 3 (...		Lus10011057 [exp]	6.9	0.9386
AT2G36780			UDP-Glycosyltransferase superf...		Lus10012148 [exp]	7.2	0.9434
AT5G10830			S-adenosyl-L-methionine-depend...		Lus10024476 [exp]	7.4	0.9414
AT2G20780		AtPLT4	Major facilitator superfamily ...		Lus10018581 [exp]	8.0	0.9139
AT3G50120			Plant protein of unknown funct...		Lus10010064 [exp]	9.0	0.9321

Compare expression of checked genes

Lus10029417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.