Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36080 69 / 7e-16 B3 ABS2, NGAL1 AP2/B3-like transcriptional factor family protein (.1.2) AT1G01030 65 / 9e-14 B3 NGA3 NGATHA3, AP2/B3-like transcriptional factor family protein (.1) AT3G61970 64 / 2e-13 B3 NGA2 NGATHA2, AP2/B3-like transcriptional factor family protein (.1) AT5G06250 63 / 2e-13 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT3G11580 63 / 3e-13 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT2G46870 63 / 3e-13 B3 NGA1 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) AT4G01500 59 / 1e-11 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G13260 59 / 1e-11 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) AT1G25560 58 / 2e-11 AP2_ERF EDF1, TEM1 TEMPRANILLO 1, ETHYLENE RESPONSE DNA BINDING FACTOR 1, AP2/B3 transcription factor family protein (.1) AT1G68840 58 / 3e-11 AP2_ERF EDF2, RAV2, RAP2.8, TEM2, AtRAV2 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004226 [exp] 94 / 3e-24 AT5G06250 183 / 4e-55 AP2/B3-like transcriptional factor family protein (.1.2) Lus10021326 [exp] 68 / 6e-15 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10041487 [exp] 59 / 1e-11 AT1G13260 416 / 8e-146 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10034276 [exp] 58 / 1e-11 AT1G68840 233 / 4e-76 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Lus10035059 [exp] 55 / 3e-10 AT1G13260 250 / 2e-96 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10021707 [exp] 55 / 4e-10 AT1G13260 369 / 1e-127 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10026212 [exp] 50 / 1e-08 AT1G51120 150 / 4e-44 AP2/B3 transcription factor family protein (.1) Lus10036282 [exp] 44 / 2e-06 AT1G50680 268 / 2e-88 AP2/B3 transcription factor family protein (.1) Lus10025226 [exp] 42 / 1e-05 AT4G32010 808 / 0.0 VP1/ABI3-LIKE 2, HSI2-like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G208100 [exp] 69 / 2e-15 AT2G36080 228 / 3e-73 AP2/B3-like transcriptional factor family protein (.1.2) Potri.016G074500 [exp] 68 / 6e-15 AT2G36080 219 / 9e-70 AP2/B3-like transcriptional factor family protein (.1.2) Potri.002G181600 [exp] 65 / 9e-14 AT2G46870 264 / 6e-86 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) Potri.014G107200 [exp] 65 / 1e-13 AT2G46870 241 / 6e-77 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) Potri.011G149700 [exp] 65 / 1e-13 AT2G46870 218 / 2e-67 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) Potri.001G452200 [exp] 61 / 2e-12 AT2G46870 198 / 4e-60 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) Potri.010G129200 [exp] 59 / 2e-11 AT1G25560 441 / 1e-154 TEMPRANILLO 1, ETHYLENE RESPONSE DNA BINDING FACTOR 1, AP2/B3 transcription factor family protein (.1) Potri.008G117100 [exp] 59 / 2e-11 AT1G25560 422 / 6e-148 TEMPRANILLO 1, ETHYLENE RESPONSE DNA BINDING FACTOR 1, AP2/B3 transcription factor family protein (.1) Potri.018G109201 [exp] 53 / 1e-09 AT1G51120 286 / 8e-95 AP2/B3 transcription factor family protein (.1) Potri.006G186301 [exp] 52 / 2e-09 AT1G51120 287 / 3e-95 AP2/B3 transcription factor family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029431 pacid=23139793 polypeptide=Lus10029431 locus=Lus10029431.g ID=Lus10029431.BGIv1.0 annot-version=v1.0 ATGTCCAGATTACCATCTTACCCCCGGACGCCATCCACCTCCGCCGCCCCCGCCATCGACGATTCTTCCCCTTCTTCGAATACATTCATCGACAAGGAAG CGATGTTCGAGAAGCCGCTGACCCCCTCCGACGTGGGGAAGCTGAACAGGCTGGTGATTCCGAAGCAGTACGCCGAGCGGTACTTCCCGATTGACCACCA TCAGCAGCAATTTTCATTGGGTGGAGGAAGAGAGGGACGAATGCGGAGACGGCGACGAATGTGA
AA sequence Show only first row Show all	>Lus10029431 pacid=23139793 polypeptide=Lus10029431 locus=Lus10029431.g ID=Lus10029431.BGIv1.0 annot-version=v1.0 MSRLPSYPRTPSTSAAPAIDDSSPSSNTFIDKEAMFEKPLTPSDVGKLNRLVIPKQYAERYFPIDHHQQQFSLGGGREGRMRRRRRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36080	B3	ABS2, NGAL1	AP2/B3-like transcriptional fa...		Lus10029431 [exp]	0	1
AT4G16480		ATINT4	inositol transporter 4 (.1)		Lus10017561 [exp]	57.2	0.7193
					Lus10039165 [exp]	66.6	0.6791
AT5G10050			NAD(P)-binding Rossmann-fold s...		Lus10019684 [exp]	70.4	0.7166

Compare expression of checked genes

Lus10029431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.