Lus10029434 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02875 62 / 2e-12 ILR1 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
AT1G44350 54 / 7e-10 ILL6 IAA-leucine resistant (ILR)-like gene 6 (.1)
AT1G51760 43 / 1e-05 JR3, IAR3 JASMONIC ACID RESPONSIVE 3, IAA-ALANINE RESISTANT 3, peptidase M20/M25/M40 family protein (.1)
AT5G54140 40 / 0.0001 ILL3 IAA-leucine-resistant (ILR1)-like 3 (.1)
AT5G56660 39 / 0.0003 ILL2 IAA-leucine resistant (ILR)-like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022761 131 / 9e-38 AT3G02875 489 / 3e-172 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Lus10016998 75 / 7e-17 AT3G02875 571 / 0.0 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Lus10021321 72 / 4e-16 AT3G02875 573 / 0.0 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Lus10025668 61 / 3e-12 AT1G44350 585 / 0.0 IAA-leucine resistant (ILR)-like gene 6 (.1)
Lus10018169 60 / 1e-11 AT1G44350 423 / 3e-147 IAA-leucine resistant (ILR)-like gene 6 (.1)
Lus10010715 48 / 2e-07 AT1G51760 463 / 1e-161 JASMONIC ACID RESPONSIVE 3, IAA-ALANINE RESISTANT 3, peptidase M20/M25/M40 family protein (.1)
Lus10029200 47 / 2e-07 AT5G56660 469 / 8e-164 IAA-leucine resistant (ILR)-like 2 (.1)
Lus10015388 47 / 2e-07 AT5G54140 461 / 7e-161 IAA-leucine-resistant (ILR1)-like 3 (.1)
Lus10030828 44 / 3e-06 AT1G51760 489 / 6e-172 JASMONIC ACID RESPONSIVE 3, IAA-ALANINE RESISTANT 3, peptidase M20/M25/M40 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G074100 93 / 2e-23 AT3G02875 508 / 1e-178 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Potri.006G207400 78 / 3e-18 AT3G02875 584 / 0.0 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Potri.006G207300 78 / 3e-18 AT3G02875 568 / 0.0 IAA-LEUCINE RESISTANT 1, Peptidase M20/M25/M40 family protein (.1)
Potri.002G082400 62 / 1e-12 AT1G44350 609 / 0.0 IAA-leucine resistant (ILR)-like gene 6 (.1)
Potri.005G178900 61 / 3e-12 AT1G44350 604 / 0.0 IAA-leucine resistant (ILR)-like gene 6 (.1)
Potri.010G035900 51 / 1e-08 AT1G51760 482 / 1e-168 JASMONIC ACID RESPONSIVE 3, IAA-ALANINE RESISTANT 3, peptidase M20/M25/M40 family protein (.1)
Potri.015G004000 44 / 3e-06 AT5G54140 520 / 0.0 IAA-leucine-resistant (ILR1)-like 3 (.1)
Potri.012G007400 40 / 8e-05 AT5G54140 548 / 0.0 IAA-leucine-resistant (ILR1)-like 3 (.1)
Potri.003G045200 40 / 8e-05 AT1G51760 680 / 0.0 JASMONIC ACID RESPONSIVE 3, IAA-ALANINE RESISTANT 3, peptidase M20/M25/M40 family protein (.1)
PFAM info
Representative CDS sequence
>Lus10029434 pacid=23139901 polypeptide=Lus10029434 locus=Lus10029434.g ID=Lus10029434.BGIv1.0 annot-version=v1.0
ATGAGGCCTTATCCAGCCACCGTGAACGACGAAGCAATGTTCGAACACGCCAAGTCCGTCGGAGGATCCCTGCTCGGAGATGGAGAATCGTCGAACGTGA
AGCTCCTTCCTGTTTCAATGGGGGCAGAGGACTTCAGCTTCTACTCGCAGAAGATGAAGGCCGCAATTTTCATGATCGGTGCCGGTGGTAGTCAACCAGA
GTGGCGGCGGAGCCTCTGCATTCGCCTCCATTGGTCCTCGATGAGGATGTTCTTTCCCCCGGCGCTGCTCTCCATGCTGCTGTCGCCATTTCTTACTTGG
ATTAGTAGCTAA
AA sequence
>Lus10029434 pacid=23139901 polypeptide=Lus10029434 locus=Lus10029434.g ID=Lus10029434.BGIv1.0 annot-version=v1.0
MRPYPATVNDEAMFEHAKSVGGSLLGDGESSNVKLLPVSMGAEDFSFYSQKMKAAIFMIGAGGSQPEWRRSLCIRLHWSSMRMFFPPALLSMLLSPFLTW
ISS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Lus10029434 0 1
AT5G53110 RING/U-box superfamily protein... Lus10003400 8.2 0.6562
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Lus10039935 12.9 0.7250
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10021655 13.2 0.7432
Lus10025936 18.6 0.6994
AT3G51250 Senescence/dehydration-associa... Lus10028439 21.4 0.6995
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10024005 23.4 0.7154
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Lus10023143 32.2 0.6700
AT1G01540 Protein kinase superfamily pro... Lus10036386 39.2 0.6948
AT1G65660 SMP1 SWELLMAP 1, Pre-mRNA splicing ... Lus10007479 39.7 0.6878
AT3G60480 unknown protein Lus10034728 44.9 0.6548

Lus10029434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.