Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62930 144 / 2e-46 Thioredoxin superfamily protein (.1) AT1G03020 141 / 3e-45 Thioredoxin superfamily protein (.1) AT5G18600 134 / 2e-42 Thioredoxin superfamily protein (.1) AT4G15680 126 / 4e-39 Thioredoxin superfamily protein (.1) AT4G15690 125 / 9e-39 Thioredoxin superfamily protein (.1) AT4G15700 124 / 2e-38 Thioredoxin superfamily protein (.1) AT4G15670 122 / 1e-37 Thioredoxin superfamily protein (.1) AT4G15660 120 / 1e-36 Thioredoxin superfamily protein (.1) AT3G21460 106 / 3e-31 Glutaredoxin family protein (.1) AT1G06830 102 / 1e-29 Glutaredoxin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005941 [exp] 211 / 1e-72 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10029440 [exp] 143 / 6e-46 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10005940 [exp] 128 / 1e-39 AT3G62930 137 / 2e-43 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 111 / 3e-33 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 111 / 4e-33 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 104 / 2e-30 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10040898 [exp] 103 / 6e-30 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 102 / 1e-29 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 93 / 1e-25 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G133800 [exp] 161 / 4e-53 AT1G03020 142 / 1e-45 Thioredoxin superfamily protein (.1) Potri.014G134000 [exp] 160 / 1e-52 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 158 / 5e-52 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.014G133900 [exp] 158 / 8e-52 AT3G62930 141 / 4e-45 Thioredoxin superfamily protein (.1) Potri.014G133700 [exp] 156 / 4e-51 AT3G62930 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.002G209000 [exp] 155 / 1e-50 AT3G62930 140 / 6e-45 Thioredoxin superfamily protein (.1) Potri.002G208700 [exp] 152 / 2e-49 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 120 / 8e-37 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 117 / 7e-36 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 117 / 2e-35 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10029441 pacid=23149356 polypeptide=Lus10029441 locus=Lus10029441.g ID=Lus10029441.BGIv1.0 annot-version=v1.0 ATGGACATGGTGGACAGATTGGTTAAAGACCAGCCATTGGTGATCTTCACCAAGAGCTCCTGCTGCATGAGCCACTCCATCACTTCGCTCATATCCGGGT TCGGAGCCAACCCAAAAATCTACGAACTAGATCAAATTCCCAACGGTCACCAAATCGAGAGTGTACTGGTGCAGCGGGGGTGCCAACCGAGCGTGCCGGC GGTGTTCATCGGACAAAAGCTGATCGGCAGCGAGAAACAGGTGATGAGCCTCCATGTTCAGAACCAACTAGTTCCAATGCTCATGCAAGCTGGAGCTATC TGGCTCTGGAAGTAG
AA sequence Show only first row Show all	>Lus10029441 pacid=23149356 polypeptide=Lus10029441 locus=Lus10029441.g ID=Lus10029441.BGIv1.0 annot-version=v1.0 MDMVDRLVKDQPLVIFTKSSCCMSHSITSLISGFGANPKIYELDQIPNGHQIESVLVQRGCQPSVPAVFIGQKLIGSEKQVMSLHVQNQLVPMLMQAGAI WLWK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62930			Thioredoxin superfamily protei...		Lus10029441 [exp]	0	1
AT3G62930			Thioredoxin superfamily protei...		Lus10029440 [exp]	1.0	0.9361
AT1G19715			Mannose-binding lectin superfa...		Lus10024291 [exp]	1.7	0.8621
AT3G62930			Thioredoxin superfamily protei...		Lus10005941 [exp]	2.0	0.8808
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10005634 [exp]	2.4	0.7708
AT5G05340			Peroxidase superfamily protein...		Lus10009932 [exp]	4.9	0.8116
AT3G22530			unknown protein		Lus10000009 [exp]	8.5	0.7613
AT4G19410			Pectinacetylesterase family pr...		Lus10034762 [exp]	11.0	0.7411
AT1G27170			transmembrane receptors;ATP bi...		Lus10011241 [exp]	11.5	0.7155
AT3G62930			Thioredoxin superfamily protei...		Lus10005940 [exp]	11.6	0.8061
AT5G21280			hydroxyproline-rich glycoprote...		Lus10038083 [exp]	12.4	0.6954

Compare expression of checked genes

Lus10029441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.