Lus10029443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03010 422 / 3e-143 Phototropic-responsive NPH3 family protein (.1)
AT2G47860 382 / 2e-127 SETH6 Phototropic-responsive NPH3 family protein (.1.2.3)
AT5G48800 220 / 2e-65 Phototropic-responsive NPH3 family protein (.1)
AT5G67385 215 / 1e-63 Phototropic-responsive NPH3 family protein (.1)
AT3G08570 208 / 8e-61 Phototropic-responsive NPH3 family protein (.1)
AT3G08660 179 / 3e-50 Phototropic-responsive NPH3 family protein (.1)
AT2G30520 178 / 8e-50 RPT2 ROOT PHOTOTROPISM 2, Phototropic-responsive NPH3 family protein (.1.2.3)
AT1G30440 172 / 4e-47 Phototropic-responsive NPH3 family protein (.1)
AT3G49970 168 / 1e-46 Phototropic-responsive NPH3 family protein (.1)
AT5G03250 166 / 2e-45 Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005943 624 / 0 AT1G03010 881 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10025928 234 / 2e-70 AT5G48800 925 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038169 225 / 3e-65 AT5G48800 482 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10014858 210 / 2e-62 AT5G67385 489 / 2e-168 Phototropic-responsive NPH3 family protein (.1)
Lus10019290 200 / 5e-59 AT5G67385 402 / 6e-135 Phototropic-responsive NPH3 family protein (.1)
Lus10011532 193 / 3e-56 AT5G67385 427 / 2e-144 Phototropic-responsive NPH3 family protein (.1)
Lus10011082 194 / 7e-56 AT5G67385 476 / 2e-162 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 179 / 1e-49 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10026511 174 / 4e-48 AT5G03250 665 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G209700 490 / 1e-169 AT1G03010 847 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.014G133500 479 / 2e-165 AT1G03010 843 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.002G242300 242 / 8e-74 AT5G48800 899 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.016G139900 234 / 9e-71 AT3G08570 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.007G053200 231 / 9e-70 AT5G67385 807 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.016G090400 174 / 2e-48 AT5G03250 768 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.001G357100 174 / 3e-48 AT1G30440 971 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.019G131600 170 / 6e-47 AT2G30520 821 / 0.0 ROOT PHOTOTROPISM 2, Phototropic-responsive NPH3 family protein (.1.2.3)
Potri.013G159000 169 / 1e-46 AT2G30520 846 / 0.0 ROOT PHOTOTROPISM 2, Phototropic-responsive NPH3 family protein (.1.2.3)
Potri.017G048200 167 / 2e-45 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0033 POZ PF00651 BTB BTB/POZ domain
CL0033 PF03000 NPH3 NPH3 family
Representative CDS sequence
>Lus10029443 pacid=23149456 polypeptide=Lus10029443 locus=Lus10029443.g ID=Lus10029443.BGIv1.0 annot-version=v1.0
ATGGGAGTTGTAACAGTTGGTGAGCTGAAACCAAGCATCTCTGGCAAAAGAAGTTTCCGTCCTAGTTCCAGCATCCGACATGCCACTGAATGGCCCATTT
CTGACGTCTCCAGTGATCTCTCAGTTGAGGTTGGAGGTTCAACCTTTGCACTTCACAAGTTCCCTCTGGTTTCACGAAGTGGAAGGATAAGAAAGCTATT
ACTGGAATTAAAAGACTCCAACAAGATCTCGAAGATAACCATCCACGGCGTCCCCGGGGGAGCAGAAGCATTCGAAGCAGCTGCAAAGTTCTGCTACGGA
ATCCACGTCGAGATCACGCTGTCAAACGTTGCGATGCTGAGGTGTGCATCCCATTTCCTGGAAATGAGCGAAGACTTCGCCGAAAAAAACATGGTAGCCA
AGGCCGAATCTTTCCTCAAGGACACGGTGCTCCCAAACATATCCAACACCATCACCGTTCTTCACAGGTGCGAATCGCTCTTGCCCGTTTCGGAAGACAT
CAATTTGGTGAACCGTCTCATCACTTCCATCGCCAACAATGCTTGCAAGGAGCAACTGGCATCCGGGTTGCTGAAGCTGGATCATAACTTCCCGTCCAAA
TTTGTGGAGCCGGATCCGTCTTCGGATTGGTGGGGGAAGTCACTCGCAAGTTTGAGTCTTGATTTGTTCCAGAGGGTGTTGACGGCTGTGAAATCAAAGG
GTTTGAAGCAGGACATGATCTGCAAGATCCTGATGAACTATGCTCGCGTTTCCTTACAGGGGCTCGCTGCTGTGAGGGATCCTCAGTTGGTTAAGGGAAC
AGTGATGGATTTGGAGCTAACAAAGAGGAAGCAAAGAGTCATTGTGGAAACAATAGTTGGGTTACTACCAACTCAGTCAAGAAAAAGTCCAGTCCCAATT
GCATTCCTTGCCAGCTTGCTCAAAGCTTCCATTTCAGCATCAGCAACCACTTCATGTAGATCAGATTTGGAGAGAAGGATTGGTCTTCAACTGGACCAAG
CCATTCTGGAAGACGTTCTGATTCCAACCAATTCCTACGGCAACAACAACAACAATAACAGCACTACAATGTATGACACTGACACCATCCTGAGGATCTT
CTCATTCTTCCTCAACTTGGACGACGATGATGACGACGATGATGAAGATCGAATGTGCGACGATCAGGGACCCGGCCCGGTACAGGCTGTGCAAGACAAT
AGACAGCCAGAAACTGTCTCAAGAGGCGTGCAGCCACGCTGCCCAGAACGAAAGGCTCCCTGTCCAGATGGCGGTCCAAGTTCTCTACTTTGA
AA sequence
>Lus10029443 pacid=23149456 polypeptide=Lus10029443 locus=Lus10029443.g ID=Lus10029443.BGIv1.0 annot-version=v1.0
MGVVTVGELKPSISGKRSFRPSSSIRHATEWPISDVSSDLSVEVGGSTFALHKFPLVSRSGRIRKLLLELKDSNKISKITIHGVPGGAEAFEAAAKFCYG
IHVEITLSNVAMLRCASHFLEMSEDFAEKNMVAKAESFLKDTVLPNISNTITVLHRCESLLPVSEDINLVNRLITSIANNACKEQLASGLLKLDHNFPSK
FVEPDPSSDWWGKSLASLSLDLFQRVLTAVKSKGLKQDMICKILMNYARVSLQGLAAVRDPQLVKGTVMDLELTKRKQRVIVETIVGLLPTQSRKSPVPI
AFLASLLKASISASATTSCRSDLERRIGLQLDQAILEDVLIPTNSYGNNNNNNSTTMYDTDTILRIFSFFLNLDDDDDDDDEDRMCDDQGPGPVQAVQDN
RQPETVSRGVQPRCPERKAPCPDGGPSSLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03010 Phototropic-responsive NPH3 fa... Lus10029443 0 1
AT1G03010 Phototropic-responsive NPH3 fa... Lus10005943 1.7 0.9616
AT5G20630 ATGER3, GLP3A, ... GERMIN-LIKE PROTEIN 3, ARABIDO... Lus10037664 2.8 0.9526
AT4G13260 YUC2 YUCCA2, Flavin-binding monooxy... Lus10007671 4.9 0.9219
AT1G13610 alpha/beta-Hydrolases superfam... Lus10019205 5.7 0.9185
AT2G46770 NAC NST1, ANAC043, ... NAC SECONDARY WALL THICKENING... Lus10002687 10.2 0.9334
AT4G15920 SWEET17, AtSWEE... Nodulin MtN3 family protein (.... Lus10015196 12.0 0.8938
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Lus10008230 14.0 0.9201
AT4G28500 NAC ANAC073, SND2, ... SECONDARY WALL-ASSOCIATED NAC ... Lus10018637 14.3 0.9397
AT1G71320 F-box family protein (.1) Lus10038210 14.3 0.9302
AT1G52190 Major facilitator superfamily ... Lus10038614 15.4 0.9212

Lus10029443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.